432 results about "Intestinal adenocarcinoma" patented technology

Monoclonal antibodies that bind specifically to Claudin 3 expressed on cell surface are provided. The antibodies of the present invention are useful for diagnosis of cancers that have enhanced expression of Claudin 3, such as ovarian cancer, prostate cancer, breast cancer, uterine cancer, liver cancer, lung cancer, pancreatic cancer, stomach cancer, bladder cancer, and colon cancer. The present invention provides monoclonal antibodies showing cytotoxic effects against cells of these cancers. Methods for inducing cell injury in Claudin 3-expressing cells and methods for suppressing proliferation of Claudin 3-expressing cells by contacting Claudin 3-expressing cells with a Claudin 3-binding antibody are disclosed. The present application also discloses methods for diagnosis or treatment of cancers.

The present invention relates to methods of preventing or inhibiting the growth of Helicobacter through the use of a composition that comprises a glucosinolate, an isothiocyanate or a derivative or metabolite thereof. The present invention also relates to methods of preventing or treating persistent chronic gastritis, ulcers and/or stomach cancer in subjects at risk for, or in need of treatment thereof.

The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.

The invention relates to nitrogen-atom-containing arteannuin dimers disclosed as Formula (1) and pharmaceutically acceptable salts thereof, wherein X is NR, NR(CH2)nNR or a formula disclosed in the specification; R is H or C14 alkyl group; Y and Z are respectively (CH2)m, (CH2)n(OCH2CH2)m, OC(CH2)nCO or COAr; Ar is phenyl group, naphthyl group or heterocyclic group; N is a 2-8 whole number, and mis a 1-11 whole number; and the heterocyclic group is quinary or sexenary, and contains 1-2 heteroatoms selected from N, O and S. The invention also provides a preparation method of the nitrogen-atom-containing arteannuin dimers, a pharmaceutical composition of the nitrogen-atom-containing arteannuin dimers, and application of the nitrogen-atom-containing arteannuin dimers in preparing drugs for treating cancers, especially endometrial carcinoma, oophoroma, cervical carcinoma, breast cancer, colon cancer, lung cancer, prostatic cancer, liver cancer and/or stomach cancer.

The invention provides a new long noncoding RNA (LncRNA) Lnc21q22.11 sequence, and a primer pair and kit for detecting expression level of the long noncoding RNA in cells and tissues. The full length of the LncRNA Lnc21q22.11 is identified to be 1202bp for the first time, the specific primers are utilized for the first time to detect the expression level of the LncRNA Lnc21q22.11 in stomach cancer cells, 35 pairs of stomach cancer line and para-carcinoma tissues, colorectal cancer cell lines and 10 pairs of colorectal cancer and para-carcinoma tissues, and thus, the kit is creative. The detection of the expression of the LncRNA Lnc21q22.11 in the stomach cancer tissues by using the kit and specific primers can be used as an effective means for stomach cancer and colorectal cancer diagnosis, curative effect observation, prognosis judgment, focus residue and relapse detection and the like. The kit is simple to operate, has the advantages of high stability and high sensitivity, and has far-reaching clinical meanings and popularization performance.

Particular anti-LFL2 antibody compositions are provided herein. These antibodies may be used for diagnosis, prognosis, therapeutic monitoring and treatment of cancer, especially breast cancer, head/neck cancer, lung cancer, ovarian cancer, stomach cancer and pancreatic cancer. Furthermore, anti-LFL2 antibodies are provided herein which target the LFL2 stump remaining after proteolytic cleavage of the extracellular domain of LFL2. Additionally, anti-LFL2 antibodies are provided herein which target the stroma surrounding cancer tumors, wherein said stroma-targeting anti-LFL2 antibodies disrupt the integrity of the stroma surrounding the cancer tumor, and also make the stroma more permeable to chemotherapeutic agents and other molecular drug agents that target tumor cells.

The invention relates to a construction method of a stomach cancer image recognition model based on artificial intelligence. The image recognition model can accurately recognize a lesion site in a stomach cancer image.

The invention provides a medicine composition for treating chronic atrophic gastritis, which has the advantages of obvious curative effect and convenient carrying. The medicine composition can not only improve various clinical symptoms of the chronic atrophic gastritis, but also improve intestinal metaplasia and heterotypic hyperplasia accompanying the chronic atrophic gastritis, thereby realizing stomach cancer prevention by the medicine. The medicine composition is prepared by the extracts of roasted milkvetch root, radix codonopsis pilosulae, dried orange peel, nutagrass flatsedge rhizome, white peony root, Chinese yam, black plum and liquorice; the preparation process is simple and is suitable for mass production; the clinical tests show that the preparation 'stomach nourishing granules' prepared by the technical proposal can fully improve various symptoms of the chronic atrophic gastritis, achieve the aim of clinical curing, and has more stable efficacies in particular to the chronic atrophic gastritis caused by weakness of the spleen and the stomach or weakness of the spleen and the stomach and qi stasis.

The invention relates to a gynostemma pentaphyllum leaf extract which is rich in damulin A, damulin b, gypenoside L and gypenoside LI, and applications of four saponin compounds to preparation of a medicament for treating tumors. Cancers are selected from lung cancer, stomach cancer, liver cancer, breast cancer or leukemia.

The invention discloses the specificity marker protein TS/MEDP antibody preparation and the purpose. The molecular biology technology is utilized, and a new gene is cloned in a stomach cancer cell and is named as TS/MDEP. A polyclonal antibody for preventing the TS/MDEP is prepared, and a high specificity antibody is acquired through the antibody purification technology. The expression characteristics of the TS/MDEP gene in a tumor cell line and a tumor cell tissue are verified from the mRNA and protein level, the expression in 14 tumor cell lines including the tumor cell line is determined, the dependance of cell cycle is assumed, the excess expression exists in stomach cancer, breast cancer and cervical cancer tissues, no expression is in the corresponding normal tissues, and the expression exists in an embryo tissue. The high expression of the TS/MDEP in the embryo tissue with exuberant cell proliferation is validated, after growing up, the gene is closed, and the high expression exists in the tumor cells. The TS/MDEP has the seasonal specificity expression to clew the occurrence and the development of the cell cycle control abnormity caused by the high expression of the TS/MDEP. The obtained antibody for preventing the TS/MDEP can be used to monitor the cell cycle advancement and the clinical biological behavior of the gastroenteric tumor.

The invention relates to a lectin microarray for detecting a carbohydrate chain marker based on sialoprotein and a detection method of the carbohydrate chain marker using the same. The lectin microarray can nondestructively detect the carbohydrate chain marker by distinguishing sialoprotein. The lectin microarray comprises a testing lectin probe group, wherein the testing lectin probe group comprises a vicia villosa lectin, an aleuria aurantia lectin, a pea lectin, a winged bean lectin-II an a winged bean lectin-I, and the winged bean lectin-II and the winged bean lectin-I are used as internal reference lectins. The lectin microarray has the advantages that the human body is not injured when the carbohydrate chain marker for detecting the carbohydrate chain marker is harmless to a human body, less samples are used, the detection speed is high and the sensitivity is high, and the lectin microarray can be applied to identification of stomach cancer.

The present invention relates to a method aiding in the assessment of cancer. It discloses the use of the human fibroblast activation protein (FAP/seprase) as a universal marker of different cancer types. Seprase aids in the assessment of pulmonary or lung cancer (LC) or of colon cancer, e.g., of non-small cell lung carcinoma (NSCLC) or colorectal cancer (CRC), but also likely of other specific types of cancer. Such specific cancer types are, e.g., esophagus, head and neck cancer, stomach cancer, bile duct cancer, pancreas cancer, kidney cancer, cervix cancer, ovary cancer, breast cancer, bladder cancer, endometrium cancer or prostate cancer. Furthermore, it especially relates to a method for assessing cancer from a liquid sample, derived from an individual by measuring seprase in said sample. Measurement of seprase can, e.g., be used in the early detection of cancer or in the surveillance of patients who undergo surgery.

An efficient angiogenesis depressant HM-3 for treating the solid tumors including stomach cancer, lung cancer and liver cancer is prepared through expressing in colibacillus by genetic engineering method, separating the protein of inclusion body, dissolving, re-naturalizing, and separating-purifying by ion change and chromatography.

The invention discloses a soap pod saponin extract, a preparation method thereof and an application for curing lung cancer, liver cancer, stomach cancer, colorectal cancer and leukemia. The soap pod saponin extract uses fructus gleditsiae or fructus gleditsiae sinensis as the raw material and is prepared by the extraction of ethanol, and the separation and the purification of macroporous resin, and the content of total saponin of the extract is more than 60 percent. The saponin extract mainly comprises various pentacyclic triterpene saponin compounds, has obvious lethal effect on the clone of the leukemia progranulocyte HL-60 and the stomach cancer transferring lymphocyte SGC7901 of people, and has remarkably inhibited effect on the tumor of mice S180 and mice having the liver cancer. When capsules prepared by the extract are used for curing 40 examples having liver cancer, lung cancer, stomach cancer and colorectal cancer, the partial remission rate is 45 percent, and the partial remission and stabilization rate is 72.5 percent. When the capsules are used for curing 30 patients who have leukemia, the complete remission rate is 66.7 percent, and the total remission rate is 90 percent which is better than that of a single chemo-treatment group. The extract can obviously lighten the toxic side effect caused by the chemo-treatment.

The invention discloses an anti-tumor combination and the application thereof; the anti-tumor combination which includes effective dose of platinum-based chemotherapy and AKT inhibitor and / or p70S6K1 inhibitor has the function of inhibiting the drug resistance of the tumor to the platinum-based chemotherapy, improves the effects of anti-tumor drugs, and can be used for preparing drugs that can resist various tumors, such as lung cancer, ovarian cancer, prostate cancer, breast cancer, stomach cancer, nasopharyngeal cancer, esophageal cancer, malignant lymphoma, head and neck squamous cell carcinoma, thyroid cancer, osteosarcoma, etc.

Disclosed herein are an HIF-1 inhibitor, a method for the preparation thereof, and a pharmaceutical composition comprising the same as an active ingredient. The HIF-1 inhibitor shows anticancer activity thanks to the inhibition activity against HIF-1, a transcription factor which plays an important role in the growth and metastasis of cancer, but not to general cytotoxicity. Thus, the HIF-inhibitor and a pharmaceutically acceptable salt thereof can be used as a therapeutic for various cancers such as liver cancer; stomach cancer and breast cancer. Also, the compound having inhibition activity against HIF-1 is useful in the treatment of diabetic retinopathy and arthritis, which are aggravated by HIF-1-mediated VEGF expression.

The present invention relates to a gene and gene product, SGA-1M that is differentially expressed in cancer tissues and cell lines. Suppression Subtractive Hybridization and microarray screening were used to screen for differential expression of SGA-1M in cancer tissues and cell lines. Expression analysis has demonstrated overexpression of SGA-1M in breast cancer tissue and breast cancer derived cell lines, in ovarian cancer, skin cancer, a cancer of the lymphoid system, thyroid cancer, pancreatic cancer, stomach cancer, and lung cancer. The gene is expressed as a 1.95 kb mRNA. The full length cDNA comprises two open reading frames encoding polypeptides of 221 and 75 amino acids, respectively. Monitoring expression levels of SGA-1M is useful for the diagnosis and prognosis of cancer as well as for evaluating the risk of developing certain types of cancers and the risk of metastasis of cancer. Reagents that target SGA-1M are useful for the treatment of cancer.

The invention relates to a 2,3-dioxyethyl-5-methyl-8,9-dimethoxy benzophenanthridine derivative disclosed as Formula I, a synthesis method and application thereof in preparing medicines for inhibiting tumor cell activity. The 50% inhibition concentrations IC50 of the 2,3-dioxyethyl-5-methyl-8,9-dimethoxy benzophenanthridine-hydrochloride and hydrobromide for four cancer cell strains of stomach cancer (MGC-803), liver cancer (BEL7402), human nasopharyngeal carcinoma (CNE) and human lung adenocarcinoma (A549) are respectively lower than those of nitidine chloride, and are much lower than those of 5-FU (control drug).

Disclosed are a chimeric antigen receptor (CAR) targeting CLD18A2, and preparation method and use thereof. The extracellular binding region of the CAR comprises a protein specifically recognizing CLD18A2. The immune effector cell modified by the CAR can be used to treat tumors such as pancreatic cancer and stomach cancer.

Compounds of Formula Ia and Ic having a lactone structure and an methylene group at the alpha-position of the lactone structure and methods for using and making the compounds have been disclosed. The lactone compounds can be reacted with an neucleaphilic agent to open the lactone ring to a compound of Formula Ib. The lactone of Formula Ia and its functional derivatives have been isolated from Securidaca virgata. These compounds are referred to as LMSV-6 or Securolide™. The purified compounds have demonstrated activity in assays for anti-bacterial and anti-fungal activities, and for treating proliferation disorders such as cancer. Based on the in vitro assays, the lactones are useful for treating proliferation disorders including, for example, breast cancer, colon cancer, rectal cancer, stomach cancer, pancreatic cancer, lung cancer, liver cancer, ovarian cancer, esophageal cancer, and leukemia. They are also effective for treatment of bacterial and fungal infections, including treatment of peptic ulcer disease, gingivitis and periodontitis. The lactone and its derivatives has the following chemical structure:

wherein R₁-R₉ and Y₁-Y₃ taken independently are preferably a hydrogen atom, a halogen atom, a hydroxyl group, or any other organic groups or groupings which optionally include a heteroatom such as oxygen, sulfur, or nitrogen groupings in linear, branched, or cyclic structural formats; Z and X are independently and preferably a heteroatom such as oxygen, sulfur, or nitrogen groupings in linear, branched, or cyclic structural formats; and Z′ may a hydrogen atom, a halogen atom, a hydroxyl group, or any other organic groups or groupings which optionally include a heteroatom such as oxygen, sulfur, or nitrogen groupings in linear, branched, or cyclic structural formats.