37results about How to "Treat osteoporosis" patented technology

Compositions, methods and kits are provided for altering the properties of a biological surface using particles such as, for instance, calcium based particles in combination with an agent that binds to the biological surface. Properties such as color, sheen, texture, strength, and odor of biological surfaces such as teeth and bone are alterable.

The invention discloses an inulin soya-bean milk beverage and a preparation method thereof, belonging to the technical field of food processing. The inulin soya-bean milk beverage disclosed by the invention mainly consists of the following components in parts by weight: 80-120 parts of soya-bean milk, 2-20 parts of inulin, 1-5 parts of honey and 0.1-0.4 parts of a stabilizer, wherein the inulin, which is also called as synanthrin, is linear straight-chain polysaccharide formed by D-fructose through key jointing of beta (1 to 2), the tail end of the inulin is provided with a glucose residue, and the degree of polymerization is 2-60. The inulin, as a soluble dietary fiber different from a starch structure, can selectively promote the growth of colon probiotics and improve the health condition of a host. The inulin soya-bean milk beverage disclosed by the invention is white, is exquisite and smooth in mouth feel, has a low caloric value and can promote the growth of human colon probiotics, inhibit toxic fermentation products, promote the absorption of mineral materials such as calcium, magnesium and iron and improve the physiological functions such as immunity of the organism.

The invention discloses a bone repair material with a multi-dimensional channel structure. The bone repair material has a layered matrix structure; a plurality of bosses I are formed in one surface of the matrix structure, and a plurality of bosses II are formed in another surface of the matrix structure; the bosses I and the bosses II are arrayed alternatively; grooves are formed between adjacent bosses I and adjacent bosses II; and a plurality of through holes are formed in a way of being perpendicular to the surfaces of the bosses I. The bone repair material provided by the invention adopts a three-dimensional network channel formed through the through holes in the matrix structure and the grooves, and the three-dimensional network channel is filled with collagenous fiber, which is favorable for cell attachment and growth as well as nerve ingrowth, and also is convenient for nutrient substance transfer and cell metabolite discharge, and also can enable cells to be evenly distributed in the interior of the material, and is favorable for even and uniform organizational formation in the interior of a support; the structural material can form firm biological gomphosis with regenerated new bone, and good structure stability can be maintained during a degradation process; the mechanical strength is high, and mechanical transmission between a bone defect part and normal bone tissue can be well achieved.

The invention discloses a health-care germanium salt and a preparation method thereof. The health-care germanium salt comprises the following components in percentage by weight: 98.1 to 98.6 percent of sea salt, 0.021 to 0.037 percent of water-soluble organic germanium, 0.21 to 0.56 percent of ferrous lactate, ferrous gluconate or ferric citrate, 0.12 to 0.25 percent of copper gluconate, 0.25 to 0.57 percent of manganese lactate or manganese gluconate, 0.21 to 0.44 percent of potassium iodide or potassium malate, 0.32 to 0.56 percent of calcium malate, calcium lactate or calcium gluconate, and 0.14 to 0.27 percent of magnesium sulfate or magnesium lactate. Powder of the raw materials is uniformly mixed in a container in percentage by weight and then sealed. The health-care germanium salt can be dissolved in water for people to bath, and active ingredients contained in the health-care germanium salt can be absorbed and penetrated through skin so as to have the effects of comprehensive health care on skin and organisms.

The invention discloses soymilk with an original flavor. The soymilk is prepared from raw materials with the following parts by weight: 90 to 100 parts of soybeans, 70 to 80 parts of white granulated sugar, 8 to 10 parts of coconut oil, 3 to 4 parts of a stabilizer, 0.1 to 0.2 part of D-sodium erythorbate, 0.3 to 0.4 part of sodium tripolyphosphate, 0.2 to 0.3 part of sodium citrate, 0.04 to 0.05 part of ethyl maltol, 0.3 to 0.4 part of table salt, and 0.7 to 0.8 part of baking soda. A preparation method comprises the following steps: a. peeling; b. soaking; c. soybean grinding; d. primary filtration; e. refined filtration; f. soymilk boiling and enzyme deactivation; g. volume fixing of the ingredients; h. homogenization; i. filling; j. sterilization.

The invention discloses a calcium carbonate vitamin C effervescent tablet with a good effervescent effect and a making method of the effervescent tablet. The effervescent tablet is prepared from vitamin C, calcium carbonate, mannitol, anhydrous citric acid, sodium bicarbonate, sodium cyclamate and leucine. The prepared effervescent tablet is sour, sweet, delicious, good in effervescent effect, wide in applicable crowd, free from sugar, pigments and essence, suitable for diabetic patients and harmless to fitness, and effervesced solution is clear.

The invention relates to a fusion protein, and a pharmaceutical composition and a use thereof, and belongs to the field of fusion protein. The fusion protein comprises 2 molecules of AC-100 linked tohuman serum albumin through a connexon, and the AC-100 has the amino acid sequence shown in SEQ ID NO:1. The 2 molecules of the AC-100 in the fusion protein show synergistic effect, have remarkable effect of promoting cartilage repair and new bone formation, and can be used for repairing cartilage and treating osteoarthritis, osteoporosis or bone fracture. At the same time, the fusion protein overcomes the shortcomings of instability and short half-life of AC-100 drugs, has significant longer half-life period in plasma and joint cavities, and is beneficial for reducing the frequency and dosageof drug administration.

The present invention discloses a human recombinant parathyroid hormone (1-34) related peptide Pro-Pro-[Arg11]hPTH(1-34)-Pro-Pro nasal drop and a production method. The main ingredient of the nasal drop is Pro-Pro-[Arg11]hPTH(1-34)-Pro-Pro, which is made into an aqueous nasal drop added with an appropriate pH buffer, a thickener, a penetration-promoting agent and a preservative. The nasal formulation avoids the pain and adverse effect (fever, etc.) caused by injection, which is especially suitable for the elder. The nasal drop can effectively cure and prevent osteoporosis with a certain value of clinical practice.

The invention provides a traditional Chinese medicine granular preparation for treating osteoporosis and belongs to the field of traditional Chinese medicine preparations. The traditional Chinese medicine granular preparation is prepared by extracting traditional Chinese medicines as follows: 18 parts of caulis tinosporae sinensis, 20 parts of campylotropis rockii schindl, 15 parts of all-grass of irisleaf oberonia, 10 parts of flueggea virosa and 20 parts of philippine violet herb. The traditional Chinese medicine granular preparation can increase the bone mineral density and treat osteoporosis.

The invention discloses a preparation method and application of a bone repair material having a multi-dimensional channel structure. The bone repair material is formed by stacking at least two laminated substrate structure layers, wherein each of the substrate structures is provided with through holes and grooves, and each of the substrate structures is prepared through substrate material preparation, substrate prefabricating, filler preparation, filling, stacking, forming, heat processing and heat treatment. According to the bone repair material prepared by the invention, three-dimensional network channels are constructed by the through holes and the grooves of the substrate structures and the channels are filled with collagen fibers, so that the bone repair material is conducive to cell adhesion growth and the in-growth of blood vessels and nerves, and the bone repair material is also convenient for transfer of nutrient substances and excretion of cell metabolites; meanwhile, cells are uniformly distributed inside the material, which is conducive to the formation of uniform and consistent tissues inside a stent; and the structural material can achieve firm biological chimerism with new bone tissues and can keep a good structural stability during degrading.

The invention provides a compound as well as a preparation method and application thereof. The compound has a structure shown as formula (I), and the compound can treat osteoporosis; moreover, by virtue of cell experiments, the compound is discovered to have an effect on promoting the proliferation of osteoblasts; and when the sample concentration is 10mu M, the proliferation rate can reach 11.24 percent.

The invention discloses a medical composition. The medical composition is prepared from the following raw materials in parts by weight of 13-17 parts of rhizoma polygonati, 10-14 parts of Chinese wolfberry fruits, 1-5 parts of cinnamon, 4-8 parts of ginseng, 4-8 parts of sea horses, and 4-8 parts of radix glycyrrhizae preparata. The invention further discloses a preparation method and applicationof the medical composition. The medical composition can notably improve osteoporosis of rats, caused by tretinoin, and also has notable effects for improving osteoporosis when being used clinically. The medical composition can also obviously prolong the swimming time of mice loading weight, the content of urea and lactic acid in serum after exercise of the mice can be reduced, the storage amount of liver glycogen is increased, and the medical composition has notable effect of relieving physical fatigue. The medical composition has good application prospects in preparation of medicines for preventing and / or treating osteoporosis and medicines for relieving fatigue.

A Chinese medicine in the form of tablet or capsule for treating the climacteric syndrome of woman, osteoporosis, and cardiovascular disease and improving immunity contains proportionally soybean isoflavone, extract of astragalus root, general saponin of gynostemma pentaphyllum, microcrystalline cellulose, cardoxymethyl starch sodium or low-substituted hydroxypropyl cellulose, and magnesium stearate. Its preparing process is also disclosed.

Apparatuses, systems and methods of treating a vertebrate organism via application of signals in a manner that enhances biological function. The signals applied can be produced by an electronic circuit, and can comprise magnetic fields emitted via one or more coil emitter devices.

The invention relates to the field of food processing, in particular to a biological processing method of red dates. According to the method, red date pulp is fermented through monascus, wine-related yeasts and saccharomyces cerevisiae in beer fermentation equipment, solid-liquid separation is conducted after fermented liquor is mature, products in a light phase, a heavy phase and a solid phase are obtained, and production of down-stream products can be conducted respectively. According to the method, the products generated by processing the red dates are completely utilized, and all the nutritious substances contained in the red dates are converted into food efficiently to be absorbed and utilized by a human body.

The invention discloses a medicine for promoting fracture healing. The medicine is characterized by being prepared from the following Chinese medicines in part by weight: 6 to 9 parts of Japanese thistle herb, 6 to 9 parts of rhubarb, 2 to 4 parts of cattail pollen, 2 to 4 parts of ground beetle, 2 to 4 parts of Chinese gall, 2 to 4 parts of root of chloranthus japonicus, 6 to 9 parts of herb of rose glorybind, 1 to 3 parts of veratrum nigrum and 1 to 3 parts of bomeol. A preparation method for the medicine comprises the following steps of: adding extracted volatile oil of the cattail pollen and the root of chloranthus japonicus, and ultrafine powder of veratrum nigrum and bomeol into an aqueous extract solution of the Japanese thistle herb, the rhubarb, the ground beetle, the Chinese gall and the rose glorybind, stirring uniformly and concentrating under reduced pressure. Clinical trials prove that the medicine for promoting the fracture healing has the characteristics of good curative effects and higher safety, so the medicine is worth clinical application and popularization.

The invention discloses selenium-containing teriparatide and fusion polypeptide for promoting osteoblast differentiation and application of the selenium-containing teriparatide and fusion polypeptide. The parent amino acid sequence of the selenium-containing teriparatide disclosed by the invention is as shown in SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF. The selenium-containing teriparatide disclosed by the invention can be used for preparing selenium-containing teriparatide. The selenium-containing teriparatide provided by the invention can effectively promote osteoblast proliferation and mineralization, prevent and / or treat osteoporosis and relieve pain of osteoporosis patients, and the polypeptides have the characteristics of high efficiency and low toxicity, and can be further developed into drugs.

The invention discloses a medicinal composition for treating osteoporosis. The medicinal composition is prepared from the following raw material components in parts by weight: 5 to 25 parts of American ginseng, 8 to 25 parts of lily bulb, 5 to 20 parts of Smilacina japonica, 3 to 10 parts of donkey-hide gelatin, 10 to 25 parts of Chinese yam and 5 to 15 parts of stem of champion bauhinia. The herbal raw materials are used as medicine, and a preparation has efficacies for dredging the channels, regulating the body and mind, tranquilizing and allaying excitement, astringing, repairing bone lesion and strengthening bones and muscles, so that the osteoporosis can be fundamentally treated, the body can be regulated, and the body condition can be improved.

The invention discloses a traditional Chinese medicine compound for treating osteoporosis and a preparation method thereof.The traditional Chinese medicine compound is prepared from, by weight, 55-65 parts of glossy privet fruit, 35-45 parts of herba cirsii japonici, 20-30 parts of rhizoma atractylodis macrocephalae, 15-25 parts of cassia twigs, 20-30 parts of radix notoginseng, 35-45 parts of cortex eucommiae, 5-15 parts of fructus citrus sarcodactylis and 40-60 parts of albizia flowers and herba epimedii, wherein the weight ratio of albizia flowers to herba epimedii is (3-5):1.Pharmacology experiments prove that the traditional Chinese medicine compound can treat the osteoporosis; traditional Chinese medicine active ingredient extract is prepared by extracting and concentrating the traditional Chinese medicine compound and can significantly treat the osteoporosis; a traditional Chinese medicine compound preparation contains the traditional Chinese medicine active ingredient extract and pharmaceutically acceptable auxiliary material carriers and can be used for treating the osteoporosis.

Apparatuses, systems and methods of treating a vertebrate organism via application of signals in a manner that enhances biological function. The signals applied can be produced by an electronic circuit, and can comprise magnetic fields emitted via one or more coil emitter devices.

The invention discloses a preparation method of a medicine for promoting fracture healing. The preparation method comprises the following steps of: adding pollen typhae, Japanese chloranthus root rhizome extraction volatile oil, black false hellebore and borneol ultrafine powder in a water extract of Circium japonicum, rheum officinale, Chinese Polyphaga, gallnut and Japanese calystegia; and uniformly stirring and decompressing and concentrating. Clinical experiments show that the medicine provided by the invention has the characteristics of good curative effect and high safety when used for promoting fracture healing and is worthy of clinically applying and popularizing.

The invention discloses an application of bispecific phosphatase DUSP5 in preventing, relieving and / or treating osteoporosis. It is found that a DUSP5 gene has the effect of treating the osteoporosis. Based on the effect of DUSP5 in treating the osteoporosis diseases, DUSP5 can be used for preparing medicines for preventing, relieving and / or treating the osteoporosis and / or other osteogenic dysfunction diseases. The connection structural domain based on the DUSP5 is a key regulation and control part for promoting osteogenic differentiation of the bone marrow mesenchymal stem cells, and the osteogenic dysfunction diseases are expected to be treated more conveniently and effectively at lower cost by only synthesizing the connection structural domain polypeptide fragment or analogue of the DUSP5 subsequently.

The invention discloses a three-dimensional printing strontium-containing mesoporous bioglass bracket loaded with soy isoflavone, and belongs to the field of the biomedical material. The bracket is composed of the strontium-containing mesoporous bioglass (Sr-MBG), polycaprolactone (PCL) and soy isoflavone, wherein the quality proportions of the Sr-MBG and PCL are 70% and 30% respectively, and 5% of Ca in the Sr-MBG is replaced by Sr. The soy isoflavone is loaded into the mesoporous of the Sr-MBG, two materials of the Sr-MBG loaded with the soy isoflavone and the PCL are printed to be the cubical biological activity bracket layer by layer by using the three-dimensional printing technology, each layer is formed by crisscrossed perpendicular lines, and the pore formed by the perpendicular lines is a square. The bracket can be applied to the repair and treatment in allusion to the bone defect, has good biocompatibility and better capacity for promoting osteogenesis and can be absorbed and degraded by the living organism. The treatment effect for the bone defect of the osteoporosis patient can be enhanced after the soy isoflavone is loaded, and the bracket is the perfect bracket material for bone tissue engineering.

The invention discloses a pharmaceutical composition for treating osteoporosis. The pharmaceutical composition is prepared from salvia miltiorrhiza, radix clematidis, dioscorea septemloba, panax pseudo-ginseng, dried ground beetle bodies and egg shells. The pharmaceutical composition has the effects of tonifying the liver and kidneys and strengthening bone and alleviating pain, and can be used for effectively treating osteoporosis with manifestations of lumbar spinal pain, soreness, weakness, asthenia, dizziness, arthralgia, numbness of the limbs and the like. The pharmaceutical composition disclosed by the invention is definite in treatment effect, low in drug dosage and free from toxic or side effects on human bodies.

The invention discloses a preparation method of a medicine for promoting fracture healing. The preparation method comprises the following steps of: adding pollen typhae, Japanese chloranthus root rhizome extraction volatile oil, black false hellebore and borneol ultrafine powder in a water extract of Circium japonicum, rheum officinale, Chinese Polyphaga, gallnut and Japanese calystegia; and uniformly stirring and decompressing and concentrating. Clinical experiments show that the medicine provided by the invention has the characteristics of good curative effect and high safety when used for promoting fracture healing and is worthy of clinically applying and popularizing.