69 results about "Osteoblast cell differentiation" patented technology

The invention provides an application of bifidobacterium animalis subsp. Lactis CP-9 in preparation of a product for promoting bone growth and development or improving bone health. Long-term research and a large number of experiments show that the bifidobacterium animalis subsp. Lactis CP-9 can improve the bone volume fraction, the bone trabecula thickness, the bone density and the bone volume of an organism, and can also effectively improve the growth hormone level and the insulin-like growth factor 1 level, so that bone growth and development are promoted. Meanwhile, the bifidobacterium animalis subsp. Lactis CP-9 can effectively improve the N-terminal propeptide level, osteocalcin level, bone morphogenetic protein level and osteoprotectin level of I-type procollagen in a body, and remarkably reduce the amino-terminal peptide level of the I-type collagen and the ligand level of nuclear factor kappa B receptor activating factor, so that osteoblast differentiation is promoted, osteoclast differentiation is inhibited, and osteoclast differentiation is inhibited. Furthermore, bone formation is promoted, bone resorption is inhibited, bone metabolism is improved, and finally the effect of improving bone health is achieved.

The invention provides a composite nanoparticle with active substance sequential release capability, a multifunctional microneedle patch based on curcumin-loaded ZIF-67 nanoparticles, preparation methods of the composite nanoparticle and the multifunctional microneedle patch and application of the multifunctional microneedle patch, and belongs to the technical field of biology. The composite nano-particles with the active substance sequential release capability are CurZIF-67NPs, the average particle size is 403 + / -7 nm, the microstructure is dodecahedral structure particles with rough textures on the surface, and the composite nano-particles have the effects of slowly releasing bioactive substances, improving the inflammatory microenvironment and regulating and controlling osteogenesis under certain conditions. The composite nano-particle comprises curcumin powder and a ZIF-67 nano-material, the ZIF-67 nano-material can be decomposed to quickly release Co < 2 + >, macrophages are regulated and controlled to be polarized to an M2 type, and excessive immune inflammation reaction is improved; the curcumin powder is slowly released, so that the periodontal ligament stem cells can be regulated and controlled to be differentiated into osteoblasts, and the osteogenic activity is enhanced.

The invention discloses a yak bone collagen peptide for improving osteoporosis and preparation and application thereof, and relates to the field of biological medicine, the yak bone collagen peptide comprises collagen peptide with the molecular weight of 500-2000 Daltons, contains a glycine-proline-hydroxyproline tripeptide core structure, can promote osteoblast differentiation and inhibit osteoclast activity, and can be used for treating osteoporosis. The amino acid sequence of the collagen peptide is any one of the following sequences: glycine-proline-hydroxyproline-glycine-glutamic acid-arginine, and the amino acid sequence of the collagen peptide is any one of the following sequences: glycine-proline-hydroxyproline-glycine-glutamic acid-arginine; and the amino acid is glycine, proline, hydroxyproline, serine, leucine and alanine. The yak bone collagen peptide has a unique glycine-proline-hydroxyproline tripeptide structure, the molecular weight is controlled within the range of 500-2000 Daltons, the structure can promote osteoblast differentiation and inhibit osteoclast activity at the same time, and the problem that a traditional osteoporosis treatment medicine is single in function is solved.

The invention discloses a method for inducing osteoblasts by using mesenchymal stem cells, and belongs to the technical field of biology. The method for inducing the osteoblasts comprises the step of adding brucella outer membrane protein into a conventional osteoblast induction culture medium to promote the dental pulp stem cells to be differentiated into the osteoblasts. According to osteoblast differentiation metaphase differentiation marker detection, the cell ALP activity of a group added with 800ng / mL of brucella outer membrane protein is 2.36 times that of a conventional osteoblast induction culture medium group; according to osteoblast differentiation end-stage differentiation marker detection, the calcium deposition amount of brucella outer membrane proteome cells added with 800ng / mL is 481.54 mu g / mg protein, and is 2.55 times of that of a conventional osteoblast induction culture medium group. By adding the brucella outer membrane protein into a conventional osteoblast induction culture medium, the osteogenic differentiation efficiency of the dental pulp stem cells can be effectively improved.

The invention discloses application of a Chibby1 (CBY1) inhibitor in preparation of an anti-osteoporosis medicine for promoting bone formation, and belongs to the technical field of biological medicines. It is found for the first time that CBY1 can inhibit bone marrow stromal cells from differentiating into osteoblasts, and bone marrow stromal cells with CBY1 gene silencing are increased in osteoblast differentiation. According to the invention, it is proposed for the first time that osteoblast differentiation can be promoted by reducing CBY1 expression or inhibiting the CBY1 function, and the CBY1 inhibitor has the potential of increasing osteogenic activity and preventing and treating osteoporosis by inhibiting CBY1 expression or inhibiting the CBY1 function.

The invention discloses an active bone defect repair material and a preparation method thereof. The bone defect repair material is prepared by compounding collagen extracted from an animal source, a calcined bone matrix and bone morphogenetic protein composite microspheres and molding through a photocuring 3D printing technology. From the perspective of bionics, collagen is used as a framework material, a calcined bone matrix with low immunogenicity is used as a hard material to enhance mechanical support of the material, and bone morphogenetic protein composite microspheres have a synergistic effect, so that undifferentiated mesenchymal stem cells are guided to develop towards a specific direction in a long-acting manner. After the active bone defect repair material is implanted into a bone defect part, a microenvironment beneficial to cell adhesion and proliferation is provided for cells, and meanwhile, bone morphogenetic protein is slowly released and can act on the bone defect part for a long time, so that the differentiation and maturation process of osteoblasts is effectively promoted, and bone repair of the bone defect part is promoted.

The invention discloses an egg yolk protein osteogenic peptide and a preparation method thereof, and belongs to the field of biological medicine and the technical field of functional food or egg product processing. According to the method, the skimmed yolk powder is subjected to enzymolysis to prepare the osteogenic bioactive peptide, enrichment and separation are carried out through macroporous resin, the preparation and enrichment process is suitable for large-scale production, and laboratory achievements can be promoted to be converted into industrial production; two osteogenic active peptides are separated and identified, DFDLPT has the activity of promoting osteoblast proliferation, and FDIDPG has the functional activity of promoting osteoblast differentiation and mineralization.

The application discloses a flavonoid compound in eaglewood as well as a preparation method and application of the flavonoid compound, and relates to the technical field of medicines. The application extracts and separates a new compound from natural eaglewood, and the new compound is used in the preparation of anti-osteoporosis drugs. The compound is detected in vitro to obtain an induction effect of the compound on the differentiation of bone marrow mesenchymal stem cells (BMSCs) into osteoblasts, so as to affect the formation of osteoclasts. Meanwhile, the compound can promote the bone development of zebra fish through RT-qPCR detection, which indicates that the compound has anti-osteoporosis activity. The separation method of the compound is simple and easy to operate.

The invention relates to the technical field of biomedical materials, in particular to a degradable zinc-based composite GBR film with the surface loaded with a nanometer electrostatic spinning fiber coating and preparation and application of the degradable zinc-based composite GBR film. According to the degradable zinc-based composite GBR membrane with the surface loaded with the nano electrostatic spinning fiber coating, the nano fiber coating is implanted into the surface of a zinc-based material such as zinc alloy by adopting an electrostatic spinning technology, and the degradable zinc-based composite GBR membrane with the surface loaded with the nano electrostatic spinning fiber coating can inhibit excessive release of zinc ions, improve biocompatibility of the zinc alloy and the like, promote osteoblast differentiation and promote angiogenesis. The electrostatic spinning coating on the surface of the zinc-based composite GBR membrane serves as a physical barrier to block invasion of epithelial cells and fibrocytes, and angiogenesis is promoted along with degradation of fibers and slow release of drugs; the porous zinc alloy and the like in the middle layer not only provide mechanical support, but also release zinc ions in the degradation process to achieve multiple functions of resisting bacteria and promoting osteogenesis.

The present invention relates to a composition comprising 4-hexylresorcinol (4-HR) as an active ingredient for prevention or treatment of a bone disease, and a formulation thereof. The composition comprising 4-hexylresorcinol (4-HR) as an active ingredient, or an ointment thereof was found to improve bone thickness, density, and strength and control bone remodeling by promoting the differentiation of osteoblasts and suppressing the proliferation and differentiation of osteoclasts in osteoporosis-induced animal models. Thus, the composition or ointment comprising 4-hexylresorcinol (4-HR) as an active ingredient can be provided as a therapeutic agent for bone diseases including bone fracture, osteoarthritis, rheumatoid arthritis, and osteoporosis.

The invention provides application of linariin-6-O-glucoside in preparation of a product for preventing and treating osteoporosis, and relates to the field of biological medicine. According to the invention, dyeing experiments of alkaline phosphatase, alizarin red and tartaric acid resistant acid phosphatase prove that the sesaminin-6-O-glucoside has affinity for FPPS receptors, has the capability of promoting bone marrow mesenchymal stem cells to form bone cells, is superior to that of bisphosphate, and can inhibit the generation of osteoclasts; microCT (micro computed tomography) detection results show that the sesaminin-6-O-glucoside has the effect of relieving the osteoporosis and can promote the formation of bone trabecula. According to the application disclosed by the invention, it is proved for the first time that the sesaminin-6-O-glucoside has the effect of resisting osteoclast formation, and meanwhile, the sesaminin-6-O-glucoside also has a better osteogenesis effect, so that a basis is provided for developing the sesaminin-6-O-glucoside as a potential medicine for treating osteoporosis.

The invention belongs to the field of cell biology, and particularly relates to a preparation method and application of an extracellular matrix of cell-engineered human collagen. The preparation method comprises the following steps: S1, culturing human induced pluripotent stem cells or a cell culture comprising the human induced pluripotent stem cells, and directly inducing differentiation to obtain induced mesenchymal stem cells or a cell culture comprising the induced mesenchymal stem cells; and S2, carrying out 3D culture on the induced mesenchymal stem cells through a 3D porous scaffold carrier. The extracellular matrix prepared by the preparation method provided by the invention is rich in collagen, so that the mesenchymal stem cells can be better promoted to be differentiated into osteoblasts, and meanwhile, a new thought is provided for the preparation of the collagen.

The invention relates to sRNA, a composition and application of the sRNA and the composition, and belongs to the field of medicinal small nucleic acid. According to the sRNA provided by the invention, the expression quantity is reduced by targeting a specific sequence of mRNA of a sclerostin gene SOST, so that the expression quantity or activity of an alkaline phosphatase gene is improved to promote osteoblast differentiation and further prevent, treat or improve bone metabolic diseases such as osteoporosis, and the sRNA is particularly suitable for treating postmenopausal osteoporosis or senile osteoporosis.

To provide a novel Lactobacillus paracasei strain with bone regeneration effects, and pharmaceutical and food compositions containing the same. [Solution] The present invention relates to a novel Lactobacillus paracasei L-30 and its uses, and more particularly to Lactobacillus paracasei L-30 (KCTC16035BP) which has the ability to promote the differentiation or formation of osteoblasts, the ability to suppress the differentiation or formation of osteoclasts, and the ability to promote immune activity, and which can regenerate bone, and to a pharmaceutical composition for the treatment or prevention of bone diseases containing the same.

The present disclosure discloses a method for isolating osteoprogenitors like mesenchymal stem cells (MSCs) from clotted bone marrow and culturing with a platelet lysate obtained from a combination of discarded umbilical cord blood and maternal blood platelet-rich plasma (instead of non-human animal origin serum) and differentiating those MSCs into osteoblasts under sterile conditions for further therapeutic applications. Particularly, the present disclosure relates to a method for expansion of osteoblasts to make cell therapy products with a fixed cell dose, which are characterized and later cryopreserved for future use through its cell culture process. Further, the present disclosure relates to identifying specific gene expression from MSCs to osteoblast formation, an in-vitro differentiation process that replicates the in-vivo bone remodelling system.

The application provides an application of miR-30d-5p and CYP24A1 inhibitor in hormone-induced femoral head necrosis, and belongs to the technical field of biological medicine.The application firstly provides a hormone-induced femoral head necrosis treatment strategy based on miR-30d-5p mimic by determining the molecular mechanism of miR-30d-5p in the regulation of CYP24A1 in the vitamin D metabolic pathway, and the direct effect is to significantly promote osteoblast differentiation and bone matrix mineralization, effectively improve bone microstructure damage and delay the femoral head collapse process; in the application significance, the application provides a new solution to the predicament of the lack of targeted drug treatment in clinic, and lays a conversion foundation for conservative treatment and hip-preserving surgery combined treatment by blocking the disease progression through specific molecular intervention.

The invention discloses an application of a branched ketonic acid dehydrogenase kinase (BCKDK) inhibitor in preparation of a medicine for preventing and treating osteoporosis. The invention finds that BCKDK can inhibit osteoblast differentiation and reduce the expression of endogenous BCKDK in osteogenic precursor cells so as to promote osteoblast differentiation; a small molecule compound inhibitor BT2 (3, 6-dichloro-2-benzothiophene carboxylic acid) of BCKDK promotes osteoblast differentiation of ovariectomized mice, inhibits osteoclast differentiation, reduces ovariectomized mouse bone loss and increases bone mass. According to the invention, the BCKDK inhibitor is proposed for the first time to be capable of promoting osteoblast differentiation, inhibiting osteoclast differentiation and increasing body bone mass by reducing BCKDK expression or inhibiting BCKDK protein biological functions, and has the effect of preventing and treating osteoporosis.

The present invention relates to a composition for the prevention, improvement, or treatment of bone diseases comprising a complex extract composed of deer antler, white soybean, Angelica gigas, and Cnidium officinale as an active ingredient. The complex extract has the effect of promoting the differentiation of bone-forming osteoblasts and bone formation, and promoting the differentiation of bone-resorbing osteoclasts and inhibiting bone resorption at an in vitro level. Furthermore, since it promotes fracture union in a fracture-induced animal model and exhibits a significant recovery effect on fractures, it can be usefully utilized as a health functional food or pharmaceutical related to bone diseases.

This invention discloses the application of agar-agar polysaccharides in the preparation of products with bone density-improving effects. The agar-agar polysaccharides are obtained from agar-agar as raw material through acid extraction, alcohol precipitation, dialysis, and ion exchange chromatography purification, with a weight-average molecular weight range of 1500-5000 Da. This invention applies agar-agar polysaccharides to the preparation of products with bone density-improving effects, including food, health products, or pharmaceuticals; particularly, it can be used to prepare functional cereal foods. The agar-agar polysaccharides of this invention have an ameliorative effect on bone density loss in a dexamethasone-induced zebrafish osteoporosis model, can enhance the activity of alkaline phosphatase (ALP) in zebrafish, and promote osteoblast differentiation.

The invention discloses application of fructus psoraleae vesicles in preparation of a medicine for preventing and / or treating orthopedic diseases. The fructus psoraleae vesicles can promote osteoblast differentiation and proliferation, and can be used for preventing and / or treating orthopedic diseases such as osteoporosis.

The present invention provides an application of animal Bifidobacterium lactis subspecies CP-9 in the preparation of a product that promotes bone growth and development or improves bone health. After long-term research and a large number of experiments, the present invention found that animal Bifidobacterium lactis subspecies CP-9 can improve the body's bone volume fraction, trabecular thickness, bone density and bone mass, and can also effectively increase the level of growth hormone and insulin-like growth factor 1, thereby promoting bone growth and development. At the same time, animal Bifidobacterium lactis subspecies CP-9 can effectively increase the level of type I procollagen N-terminal propeptide, osteocalcin level, bone morphogenetic protein level, and osteoprotegerin level in the body, and significantly reduce the level of type I collagen amino-terminal peptide and nuclear factor κB receptor activator ligand level, thereby promoting osteoblast differentiation, inhibiting osteoclast differentiation, and then promoting bone formation, inhibiting bone resorption, improving bone metabolism, and ultimately achieving the effect of improving bone health.

The application discloses a SrCO3@ZIF-8 / polymer composite bone scaffold and a preparation method thereof, and comprises the following steps: growing zeolite imidazolate framework-8 (ZIF-8) on the surface of SrCO3 in situ to prepare SrCO3@ZIF-8 microrods, uniformly mixing the SrCO3@ZIF-8 microrods and a polymer material through grinding, and preparing the SrCO3@ZIF-8 / polymer composite bone scaffold by using a selective laser sintering technology. The SrCO3@ZIF-8 / polymer composite bone scaffold obtained by the application is applied to bone defect repair, and the Zn ions and Sr ions generated by in-vivo degradation of the scaffold can promote the differentiation of stem cells into osteoblasts, endow the scaffold with osteogenic activity, promote the polarization of macrophages into M2 type and the expression of related anti-inflammatory factors, and strengthen the anti-inflammatory performance of the scaffold. In addition, the ZIF-8 contains a large number of 2-methyl imidazole organic ligands, can form a strong interface with the molecular chain of the polymer, solves the problem of interface incompatibility between SrCO3 and the polymer, and thus improves the mechanical performance of the scaffold.

The invention relates to a bone repair micro-nano robot with magnetic control targeting performance as well as a preparation method and application thereof, and belongs to the technical field of biological materials. In the micro-nano robot, a biodegradable polymer and Fe3O4 magnetic nanoparticles are compounded into magnetic particles, and CeO2 nanoparticles are coated on the surfaces of the magnetic particles through an electrostatic adsorption effect. The method is easy to operate and high in preparation efficiency, the obtained micro-nano robot is uniform in particle size, targeted driving of a single micro-nano robot and a group micro-nano robot can be achieved in a magnetic field, toxic and side effects on organisms are low, bone marrow mesenchymal stem cells can be promoted to be differentiated into osteoblasts, and active oxygen in the environment can be removed.

The application discloses a pea peptide mixture with calcium binding and osteogenesis promoting effects and application thereof, wherein the pea peptide mixture is derived from protein components in a by-product of pea starch extraction, is obtained through alkaline protease and papain enzymolysis and separation and purification, and is rich in aspartic acid and glutamic acid residues. The pea peptide mixture can effectively bind with calcium ions, the pea peptide mixture can promote calcium ion delivery in osteoblasts, improve alkaline phosphatase activity, and promote osteoblast differentiation, the osteogenesis promoting effect of the pea peptide mixture is related to epidermal growth factor receptor EGFR and downstream PI3K-Akt signal pathway regulation. The pea peptide mixture can improve glucocorticoid-induced zebrafish bone mass reduction, and up-regulate mRNA expression levels of ALP, EGFR, PI3K and Akt and other genes related to osteogenesis. The pea peptide mixture has both functions and nutrition, can be used for preparing products for promoting osteogenesis, improving bone mass, improving bone mass reduction and assisting in improving osteoporosis, and has a wide application prospect in the field of bone health.

The invention discloses a preparation method and application of IBFO (at) high-entropy alloy heterojunction piezoelectric hydrogel (IBHA-SAPS), and the preparation method comprises the following steps: preparing high-entropy alloy (HEA) powder through sol-gel and calcination, compounding the HEA powder with bismuth-doped bismuth ferrite (IBFO) to construct an IBFO (at) HEA heterojunction (IBHA), and finally carrying out cross-linking molding with a sodium alginate-phenylboronic acid polymer. Under ultrasonic stimulation, the piezoelectric effect of the hydrogel can synergistically enhance the sonodynamic performance and the nano-enzyme activity, and in an acidic microenvironment, efficient antibiosis and biological membrane removal can be achieved through high-intensity ultrasound; in a neutral physiological microenvironment, low-intensity ultrasound can trigger the composite material to remove active oxygen so as to relieve oxidative stress and generate an electric signal to promote osteoblast differentiation, and the composite material has good biocompatibility, injectability and intelligent responsiveness and has wide application prospects in the fields of sonodynamic therapy, tissue engineering scaffolds, infectious bone defect repair and the like.

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The invention discloses application of an ECRG4 gene in preparation of drugs for prevention, treatment, adjuvant treatment, alleviation or alleviation of bone imbalance related diseases, and relates to the technical field of biology. By overexpressing the ECRG4 gene, the effects of prevention, treatment, adjuvant therapy, alleviation or alleviation of bone imbalance related diseases are achieved, osteoblast differentiation is promoted and / or osteoclast formation is inhibited, and the overexpressed ECRG4 gene has a nucleotide sequence as shown in SEQ ID NO: 1. It is found for the first time that the ECRG4 gene can be used as an effective target for prevention, treatment, adjuvant treatment, and alleviation or alleviation of bone imbalance related diseases. Overexpression of the ECRG4 gene can effectively promote osteogenic differentiation to facilitate bone regeneration and inhibit osteoclast differentiation to facilitate bone resorption, which reveals that the ECRG4 gene has potential application in bone-related diseases, including but not limited to fracture healing, osteoporosis, osteolysis and the like, and has broad application prospects. And a new direction is provided for prevention, treatment, adjuvant treatment and alleviation or alleviation of bone imbalance related diseases.

This invention provides a bone regeneration formula based on collagen synergy and its preparation method. The formula uses low-molecular-weight collagen peptides as organic templates and forms hydroxyapatite-like nanostructures through ion-induced mineralization, achieving a tight organic-inorganic interface. The formula can regulate osteoblast differentiation and inhibit osteoclast activity, thereby improving bone density and bone tissue regeneration capacity. The preparation process adopts a low-temperature enzymatic hydrolysis and biomimetic mineralization coupling process to maintain the stability of the active structure. Experimental results show that the formula is superior to conventional formulas in terms of molecular expression, mineralization capacity, and bone metabolism regulation.

A Lactobacillus paracasei L-30 strain deposited under Accession Number KCTC16035BP has ability to promote osteoblast differentiation or formation, inhibiting osteoclast differentiation or formation, and enhancing immune activity, thereby enabling bone regeneration. A pharmaceutical composition including the Lactobacillus paracasei L-30 strain, a lysate thereof, a culture thereof, an extract thereof, and / or a fraction of the extract may be used for treating or preventing bone diseases.