31 results about "Osteoblast cell differentiation" patented technology

The invention discloses application of a Chibby1 (CBY1) inhibitor in preparation of an anti-osteoporosis medicine for promoting bone formation, and belongs to the technical field of biological medicines. It is found for the first time that CBY1 can inhibit bone marrow stromal cells from differentiating into osteoblasts, and bone marrow stromal cells with CBY1 gene silencing are increased in osteoblast differentiation. According to the invention, it is proposed for the first time that osteoblast differentiation can be promoted by reducing CBY1 expression or inhibiting the CBY1 function, and the CBY1 inhibitor has the potential of increasing osteogenic activity and preventing and treating osteoporosis by inhibiting CBY1 expression or inhibiting the CBY1 function.

The application discloses a flavonoid compound in eaglewood as well as a preparation method and application of the flavonoid compound, and relates to the technical field of medicines. The application extracts and separates a new compound from natural eaglewood, and the new compound is used in the preparation of anti-osteoporosis drugs. The compound is detected in vitro to obtain an induction effect of the compound on the differentiation of bone marrow mesenchymal stem cells (BMSCs) into osteoblasts, so as to affect the formation of osteoclasts. Meanwhile, the compound can promote the bone development of zebra fish through RT-qPCR detection, which indicates that the compound has anti-osteoporosis activity. The separation method of the compound is simple and easy to operate.

The invention relates to the technical field of biomedical materials, in particular to a degradable zinc-based composite GBR film with the surface loaded with a nanometer electrostatic spinning fiber coating and preparation and application of the degradable zinc-based composite GBR film. According to the degradable zinc-based composite GBR membrane with the surface loaded with the nano electrostatic spinning fiber coating, the nano fiber coating is implanted into the surface of a zinc-based material such as zinc alloy by adopting an electrostatic spinning technology, and the degradable zinc-based composite GBR membrane with the surface loaded with the nano electrostatic spinning fiber coating can inhibit excessive release of zinc ions, improve biocompatibility of the zinc alloy and the like, promote osteoblast differentiation and promote angiogenesis. The electrostatic spinning coating on the surface of the zinc-based composite GBR membrane serves as a physical barrier to block invasion of epithelial cells and fibrocytes, and angiogenesis is promoted along with degradation of fibers and slow release of drugs; the porous zinc alloy and the like in the middle layer not only provide mechanical support, but also release zinc ions in the degradation process to achieve multiple functions of resisting bacteria and promoting osteogenesis.

The present invention relates to a composition comprising 4-hexylresorcinol (4-HR) as an active ingredient for prevention or treatment of a bone disease, and a formulation thereof. The composition comprising 4-hexylresorcinol (4-HR) as an active ingredient, or an ointment thereof was found to improve bone thickness, density, and strength and control bone remodeling by promoting the differentiation of osteoblasts and suppressing the proliferation and differentiation of osteoclasts in osteoporosis-induced animal models. Thus, the composition or ointment comprising 4-hexylresorcinol (4-HR) as an active ingredient can be provided as a therapeutic agent for bone diseases including bone fracture, osteoarthritis, rheumatoid arthritis, and osteoporosis.

The invention provides application of linariin-6-O-glucoside in preparation of a product for preventing and treating osteoporosis, and relates to the field of biological medicine. According to the invention, dyeing experiments of alkaline phosphatase, alizarin red and tartaric acid resistant acid phosphatase prove that the sesaminin-6-O-glucoside has affinity for FPPS receptors, has the capability of promoting bone marrow mesenchymal stem cells to form bone cells, is superior to that of bisphosphate, and can inhibit the generation of osteoclasts; microCT (micro computed tomography) detection results show that the sesaminin-6-O-glucoside has the effect of relieving the osteoporosis and can promote the formation of bone trabecula. According to the application disclosed by the invention, it is proved for the first time that the sesaminin-6-O-glucoside has the effect of resisting osteoclast formation, and meanwhile, the sesaminin-6-O-glucoside also has a better osteogenesis effect, so that a basis is provided for developing the sesaminin-6-O-glucoside as a potential medicine for treating osteoporosis.

To provide a novel Lactobacillus paracasei strain with bone regeneration effects, and pharmaceutical and food compositions containing the same. [Solution] The present invention relates to a novel Lactobacillus paracasei L-30 and its uses, and more particularly to Lactobacillus paracasei L-30 (KCTC16035BP) which has the ability to promote the differentiation or formation of osteoblasts, the ability to suppress the differentiation or formation of osteoclasts, and the ability to promote immune activity, and which can regenerate bone, and to a pharmaceutical composition for the treatment or prevention of bone diseases containing the same.

The invention discloses an application of a branched ketonic acid dehydrogenase kinase (BCKDK) inhibitor in preparation of a medicine for preventing and treating osteoporosis. The invention finds that BCKDK can inhibit osteoblast differentiation and reduce the expression of endogenous BCKDK in osteogenic precursor cells so as to promote osteoblast differentiation; a small molecule compound inhibitor BT2 (3, 6-dichloro-2-benzothiophene carboxylic acid) of BCKDK promotes osteoblast differentiation of ovariectomized mice, inhibits osteoclast differentiation, reduces ovariectomized mouse bone loss and increases bone mass. According to the invention, the BCKDK inhibitor is proposed for the first time to be capable of promoting osteoblast differentiation, inhibiting osteoclast differentiation and increasing body bone mass by reducing BCKDK expression or inhibiting BCKDK protein biological functions, and has the effect of preventing and treating osteoporosis.

This invention discloses the application of agar-agar polysaccharides in the preparation of products with bone density-improving effects. The agar-agar polysaccharides are obtained from agar-agar as raw material through acid extraction, alcohol precipitation, dialysis, and ion exchange chromatography purification, with a weight-average molecular weight range of 1500-5000 Da. This invention applies agar-agar polysaccharides to the preparation of products with bone density-improving effects, including food, health products, or pharmaceuticals; particularly, it can be used to prepare functional cereal foods. The agar-agar polysaccharides of this invention have an ameliorative effect on bone density loss in a dexamethasone-induced zebrafish osteoporosis model, can enhance the activity of alkaline phosphatase (ALP) in zebrafish, and promote osteoblast differentiation.

The invention discloses application of fructus psoraleae vesicles in preparation of a medicine for preventing and / or treating orthopedic diseases. The fructus psoraleae vesicles can promote osteoblast differentiation and proliferation, and can be used for preventing and / or treating orthopedic diseases such as osteoporosis.

The application discloses a pea peptide mixture with calcium binding and osteogenesis promoting effects and application thereof, wherein the pea peptide mixture is derived from protein components in a by-product of pea starch extraction, is obtained through alkaline protease and papain enzymolysis and separation and purification, and is rich in aspartic acid and glutamic acid residues. The pea peptide mixture can effectively bind with calcium ions, the pea peptide mixture can promote calcium ion delivery in osteoblasts, improve alkaline phosphatase activity, and promote osteoblast differentiation, the osteogenesis promoting effect of the pea peptide mixture is related to epidermal growth factor receptor EGFR and downstream PI3K-Akt signal pathway regulation. The pea peptide mixture can improve glucocorticoid-induced zebrafish bone mass reduction, and up-regulate mRNA expression levels of ALP, EGFR, PI3K and Akt and other genes related to osteogenesis. The pea peptide mixture has both functions and nutrition, can be used for preparing products for promoting osteogenesis, improving bone mass, improving bone mass reduction and assisting in improving osteoporosis, and has a wide application prospect in the field of bone health.

The invention discloses a preparation method and application of IBFO (at) high-entropy alloy heterojunction piezoelectric hydrogel (IBHA-SAPS), and the preparation method comprises the following steps: preparing high-entropy alloy (HEA) powder through sol-gel and calcination, compounding the HEA powder with bismuth-doped bismuth ferrite (IBFO) to construct an IBFO (at) HEA heterojunction (IBHA), and finally carrying out cross-linking molding with a sodium alginate-phenylboronic acid polymer. Under ultrasonic stimulation, the piezoelectric effect of the hydrogel can synergistically enhance the sonodynamic performance and the nano-enzyme activity, and in an acidic microenvironment, efficient antibiosis and biological membrane removal can be achieved through high-intensity ultrasound; in a neutral physiological microenvironment, low-intensity ultrasound can trigger the composite material to remove active oxygen so as to relieve oxidative stress and generate an electric signal to promote osteoblast differentiation, and the composite material has good biocompatibility, injectability and intelligent responsiveness and has wide application prospects in the fields of sonodynamic therapy, tissue engineering scaffolds, infectious bone defect repair and the like.

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

This invention provides a bone regeneration formula based on collagen synergy and its preparation method. The formula uses low-molecular-weight collagen peptides as organic templates and forms hydroxyapatite-like nanostructures through ion-induced mineralization, achieving a tight organic-inorganic interface. The formula can regulate osteoblast differentiation and inhibit osteoclast activity, thereby improving bone density and bone tissue regeneration capacity. The preparation process adopts a low-temperature enzymatic hydrolysis and biomimetic mineralization coupling process to maintain the stability of the active structure. Experimental results show that the formula is superior to conventional formulas in terms of molecular expression, mineralization capacity, and bone metabolism regulation.

A Lactobacillus paracasei L-30 strain deposited under Accession Number KCTC16035BP has ability to promote osteoblast differentiation or formation, inhibiting osteoclast differentiation or formation, and enhancing immune activity, thereby enabling bone regeneration. A pharmaceutical composition including the Lactobacillus paracasei L-30 strain, a lysate thereof, a culture thereof, an extract thereof, and / or a fraction of the extract may be used for treating or preventing bone diseases.

The invention relates to the technical field of biology, in particular to novel application of sanguinarine (SAN), a method for inducing human amniotic mesenchymal stem cells (hAMSCs) to be differentiated into osteoblasts through COX2 protein and an osteogenic induction culture medium for the inducing method, and the method can be applied to the fields of bone disease treatment drug research and development and clinical transformation. It is proved for the first time that SAN mediates hAMSCs osteogenic differentiation through COX2 protein, SAN can significantly improve expression of COX2 gene (PTGS2) in hAMSCs, the osteogenic effect of SAN can be reversed by adding a COX2 inhibitor (such as celecoxib), and direct experimental evidence is provided for'COX2 serving as a small molecule drug to promote osteogenic differentiation '.

The invention discloses application of an RUFY4 gene in promoting osteogenic differentiation of osteoblasts, and relates to the field of osteoporosis treatment. The method comprises the following steps: constructing an overexpression lentiviral vector containing RUFY4; mouse bone marrow stromal stem cells are transfected by using the RUFY4 gene, so that RUFY4 overexpressed KUSA-O cells are obtained; the osteogenic differentiation capacity of KUSA-O cells is detected through ALP dyeing and alizarin red S dyeing, and the osteogenic differentiation promoting effect of the RUFY4 is verified. Furthermore, ossification-related gene and protein expression are detected through Western blot, qRT-PCR (quantitative reverse transcription-polymerase chain reaction) and immunofluorescence, and it is clear that RUFY4 promotes osteogenic differentiation through PI3K / AKT and / Wnt / beta-catenin signal channels. Transcriptomics analysis proves that the RUFY4 has a positive regulation effect on osteoblast differentiation, bone formation and bone density recovery of osteoporosis patients are facilitated, and a new strategy is provided for osteoporosis targeted therapeutic drugs.

The invention discloses lactobacillus plantarum and application thereof in promoting bone health and regulating intestinal flora. The name of the lactobacillus plantarum is lactobacillus plantarum GXS77, the preservation number of the lactobacillus plantarum is CGMCC No.35899, and the lactobacillus plantarum is preserved in China General Microbiological Culture Collection Center (CGMCC) in No. 3, No.1 Yard, Beichen West Road, Chaoyang District, Beijing in 2025. The yield of acetic acid and the yield of butyric acid of the lactobacillus plantarum GXS77 obtained through screening are increased by 18% and 16% respectively compared with the yield of acetic acid and the yield of butyric acid of common lactobacillus plantarum, the peak calcium absorption capacity of Caco-2 cells can be increased by 12.3%, osteoblasts are differentiated, and then bone health is promoted; meanwhile, the lactobacillus plantarum GXS77 has good acid resistance, cholate resistance and a good cell adhesion effect. Therefore, the strain can be used for developing fermented food, health-care products and medicines with the effects of promoting bone health, regulating intestinal flora and the like.

The application discloses egg yolk protein osteogenic peptides and a preparation method thereof, and belongs to the fields of biological medicines, functional food or egg product processing technologies. The application adopts defatted egg yolk powder enzymolysis to prepare osteogenic active peptides, and the osteogenic active peptides are enriched and separated through macroporous resins; the preparation and enrichment process is suitable for large-scale production, and can promote transformation from laboratory achievements to industrial production; two osteogenic active peptides are separated and identified, wherein, DFDLPT has the function of promoting osteoblast proliferation activity, and FDIDPG has the function of promoting osteoblast differentiation and mineralization.

The invention discloses BPDAH / VMA hydrogel sustained-release microspheres for promoting periodontal bone regeneration as well as a preparation method and application of the BPDAH / VMA hydrogel sustained-release microspheres, and provides a new material selection for clinical treatment of periodontal bone regeneration, so that the BPDAH / VMA hydrogel sustained-release microspheres can continuously and efficiently promote periodontal bone tissue regeneration, regulate and control an osteogenesis microenvironment and reduce postoperative complications such as infection. The method is expected to become a preferable scheme widely applied to clinical treatment materials, has good clinical application potential, and is expected to provide a new direction for design of other periodontal tissue regeneration and bone regeneration repair materials. VMA is innovatively grafted on the surfaces of the GelMA hydrogel microspheres, and B (at) PH NPs are adsorbed and loaded, so that the GelMA hydrogel microspheres have the curative effects of regulating an osteogenesis microenvironment and inducing periodontal osteoblast differentiation. According to the invention, the hydrogel microsphere is directly injected into the periodontal pocket near the periodontal bone tissue defect, and the osteogenesis microenvironment can be regulated and controlled and osteoblast differentiation can be induced through the slow release effect of the hydrogel microsphere on loaded osteogenesis and anti-inflammatory components, so that periodontal bone regeneration is promoted.

The invention discloses an antibacterial drug modified strontium-doped orthopedic implant material and a preparation method and application thereof, and relates to the technical field of bone repair materials, the material comprises a base material, and a strontium-doped functional layer, an antibacterial drug functional layer and a slow-release functional layer which are sequentially formed on the surface of the base material; wherein the strontium-doped functional layer is of a composite structure formed by loading strontium ions in a polypolyphenol or polyphenol amine matrix formed by auto-polymerization of polyphenol or phenol amine compounds. According to the invention, sequential release of functional factors is realized through layered structure design: an antibacterial drug is rapidly released in the early stage of implantation to inhibit bacterial infection, an anti-inflammatory and anti-oxidation effect is continuously exerted in the middle stage, strontium ions are stably and slowly released in the later stage to improve an immune microenvironment and promote osteoblast differentiation and bone matrix deposition, and three-layer functions have a synergistic effect, so that the bone repair effect is improved. The vicious circle of infection-inflammation-oxidative stress-immune imbalance is effectively broken through, and the method can be widely applied to the scenes of orthopedic clinical operations, oral and maxillofacial surgical reconstruction, diabetes-related bone defect repair, infectious bone defect treatment and the like.

The application provides a Chinese medicine composition containing Notopterygium incisum and Lonicera japonica in preparation and treatment of rheumatoid arthritis, and belongs to the technical field of medicine; scientific research shows that the Chinese medicine composition containing Notopterygium incisum and Lonicera japonica can reduce joint cartilage destruction, subchondral bone destruction caused by rheumatoid arthritis, promote osteoblast differentiation and mineralization, reduce joint swelling, synovial hyperplasia, and inflammatory cell infiltration of joints caused by rheumatoid arthritis, has the effect of treating rheumatoid arthritis, and can be developed into a medicine for treating rheumatoid arthritis.

This specification discloses use of vitamin D for treating fibrous dysplasia. Vitamin D is involved in a wide range of abnormal signaling pathways found in fibrous dysplasia tissue, thereby restoring the affected tissue to a normal state. Specifically, when vitamin D is administered to tissue with fibrous dysplasia, vitamin D prevents cAMP overproduction, promotes pre-osteogenic differentiation and osteoblast maturation, helps normal mineralization of osteoblasts, prevents fibrogenic differentiation, and prevents fibroblast-mediated tissue fibrosis. Vitamin D is an essential substance for humans, is a substance that has already been proven to be stable in various diseases, and has the advantage of targeting and treating the fundamental pathological characteristics of fibrous dysplasia.

The invention discloses a preparation method of a porous composite material based on hydroxyapatite, magnesium oxide and tannic acid, which comprises the following steps: by taking polyethylene glycol diacrylate as a photo-crosslinking monomer and diphenyl (2, 4, 6-trimethylbenzoyl) phosphine oxide as a photoinitiator, carrying out a hydrothermal reaction to prepare the porous composite material based on hydroxyapatite, magnesium oxide and tannic acid. Nano hydroxyapatite, nano magnesium oxide and tannic acid are uniformly dispersed in a monomer solution to form photocuring slurry, and the photocuring slurry is formed under ultraviolet light through a photocuring 3D printing technology. Wherein the nano hydroxyapatite provides osteoconductivity, the nano magnesium oxide releases magnesium ions to promote osteoblast differentiation, and the tannic acid endows the material with antibacterial and anti-inflammatory properties; according to the composite material bone scaffold, a Gyandroid structure in a three-period extremely small curved surface is adopted as a scaffold structure, and the structure is combined with the functional synergistic effect of all components, so that the prepared composite material bone scaffold has high porosity, excellent compressive strength, remarkable biological activity and active antibacterial and anti-inflammatory capacity at the same time, and repair and regeneration of bone tissues can be effectively promoted.

The invention discloses sustained-release oral powder for treating osteoporosis and a preparation method of the sustained-release oral powder. The sustained-release oral powder comprises 2 parts of a supramolecular metal organic framework material sMOF, 0.8-1.0 part of microcrystalline cellulose and 0.1-0.2 part of magnesium stearate. Wherein the supramolecular metal organic framework material sMOF is formed by coordination self-assembly of Sr < 2 + >, Mg < 2 + >, alendronate (ALN), 1, 6-fructose diphosphate sodium salt (FDP) and casein phosphopeptides (CPP). The powder has excellent treatment effect, biocompatibility and slow release characteristic, can effectively promote osteoblast differentiation, inhibit osteoclast activity and reverse bone mineral density decline, and is suitable for treatment of bone diseases such as osteoporosis and fracture.

The invention discloses a titanium sheet / MXene composite material and a preparation method and application thereof, and relates to the technical field of medical materials.The preparation method comprises the following steps that 1, titanium aluminum carbide powder is subjected to acid etching, centrifugation, washing, ultrasonic stripping and drying, and MXene nanosheets are obtained; (2) dispersing the MXene nanosheets in deionized water, so as to obtain an MXene dispersion liquid; and (3) coating the surface of the titanium sheet subjected to alkali etching with the MXene dispersion liquid, and drying to obtain the titanium sheet / MXene composite material. The composite material can inhibit expression of macrophage inflammatory factors and promote M2 polarization of macrophages, so that inflammation is relieved, and the treatment potential of the composite material in the aspect of medical implant application is highlighted through a unique mechanism of promoting osteoblast differentiation and vascular cell differentiation through autophagy mediation.

The invention relates to the technical field of food and bioactive peptide preparation, in particular to an ion-modified cubilose peptide compound for improving bone mineral density and promoting growth and development as well as a preparation method and application of the ion-modified cubilose peptide compound. The cubilose peptide compound comprises cubilose peptide modified by metal ions, and the metal ion loading capacity of the cubilose peptide compound is 15-25%. According to the ion-modified cubilose peptide compound disclosed by the invention, through metal ion modification, the binding capacity of cubilose peptide to metal ions is improved, so that the ion-modified cubilose peptide compound has antioxidant activity and biological activity for promoting osteoblast differentiation, and the nutritional function characteristics of a product are improved. Aiming at the particularity of the cubilose peptide structure, the metal ion modification method provided by the invention can improve the modification stability and batch consistency, improve the metal ion loading amount, and reduce the influence on the cubilose peptide nutritional ingredients. The preparation method is simple and convenient to operate and suitable for large-scale production and application.

The invention discloses application of lycoris radiata exosomes in preparation of a medicine for treating ectopic ossification, and belongs to the technical field of biological medicine. According to the prepared dried lycoris radiata exosome La-dEXOs, osteoclast differentiation and osteoblast differentiation experiments and animal experiments prove that the prepared La-dEXOs can improve ectopic ossification of rats by promoting osteoclast differentiation and inhibiting osteoblast differentiation. Experimental results show that La-dEXOs has the potential to be developed into related medical products for preventing and treating ectopic ossification.

The application discloses application of a Chibby1 (CBY1) inhibitor in preparation of an anti-osteoporosis drug for promoting bone formation, and belongs to the technical field of biological medicines. It is found for the first time that CBY1 can inhibit differentiation of bone marrow stromal cells into osteoblasts, and that bone marrow stromal cells with CBY1 gene silencing have increased osteogenic differentiation. It is proposed for the first time that reducing CBY1 expression or inhibiting the function of CBY1 can promote differentiation of osteoblasts, and that a CBY1 inhibitor has the potential of increasing osteogenic activity and preventing and treating osteoporosis by inhibiting CBY1 expression or inhibiting the function of CBY1.

This invention discloses the application of Morkotin A (quercetin-3-O-rutin-7-O-glucoside) in the preparation of pharmaceuticals, health foods, or functional foods, belonging to the field of biomedical technology. Animal experiments have demonstrated that Morkotin A can significantly increase bone mineral density in ovariectomized osteoporotic mice, improve bone microstructure, and regulate calcium and phosphorus metabolism and bone turnover marker levels. Simultaneously, in vitro cell experiments have confirmed that Morkotin A can significantly promote osteoblast differentiation and inhibit osteoclast formation. The Morkotin A used in this invention is derived from the medicinal and edible herb, Lycium barbarum leaf, and has high safety. Both in vitro and in vivo experiments have confirmed that Morkotin A promotes bone formation and inhibits bone resorption, making it suitable for development as a drug for the prevention and treatment of osteoporosis, or as a health food or functional food that helps improve bone mineral density.

The invention belongs to the technical field of inorganic functional materials and composite materials, and particularly relates to a two-dimensional S-type heterojunction composite material and a preparation method and application thereof. The two-dimensional S-type heterojunction composite material is formed by self-assembly of g-C3N4, WO3 and WO3.H2O, and the chemical formula of the two-dimensional S-type heterojunction composite material is WO3 / WO3.H2O / g-C3N4; wherein the g-C3N4 is of a porous layered two-dimensional structure, and the WO3 is of a nanosheet structure. According to the method, a two-dimensional S-shaped heterojunction in which WO3, WO3.H2O and g-C3N4 are tightly coupled is constructed in situ through an exquisite process design, so that the photocatalytic degradation efficiency of the material on pollutants and antibiotics is remarkably improved, more importantly, good biocompatibility of the material is proved through systematic biotoxicity evaluation, and the material has a good application prospect. And a foundation is laid for further exploring the application of the gene in promoting osteoblast differentiation.