54 results about "Osteoblast cell differentiation" patented technology

The invention discloses a yak bone collagen peptide for improving osteoporosis and preparation and application thereof, and relates to the field of biological medicine, the yak bone collagen peptide comprises collagen peptide with the molecular weight of 500-2000 Daltons, contains a glycine-proline-hydroxyproline tripeptide core structure, can promote osteoblast differentiation and inhibit osteoclast activity, and can be used for treating osteoporosis. The amino acid sequence of the collagen peptide is any one of the following sequences: glycine-proline-hydroxyproline-glycine-glutamic acid-arginine, and the amino acid sequence of the collagen peptide is any one of the following sequences: glycine-proline-hydroxyproline-glycine-glutamic acid-arginine; and the amino acid is glycine, proline, hydroxyproline, serine, leucine and alanine. The yak bone collagen peptide has a unique glycine-proline-hydroxyproline tripeptide structure, the molecular weight is controlled within the range of 500-2000 Daltons, the structure can promote osteoblast differentiation and inhibit osteoclast activity at the same time, and the problem that a traditional osteoporosis treatment medicine is single in function is solved.

The invention discloses application of a Chibby1 (CBY1) inhibitor in preparation of an anti-osteoporosis medicine for promoting bone formation, and belongs to the technical field of biological medicines. It is found for the first time that CBY1 can inhibit bone marrow stromal cells from differentiating into osteoblasts, and bone marrow stromal cells with CBY1 gene silencing are increased in osteoblast differentiation. According to the invention, it is proposed for the first time that osteoblast differentiation can be promoted by reducing CBY1 expression or inhibiting the CBY1 function, and the CBY1 inhibitor has the potential of increasing osteogenic activity and preventing and treating osteoporosis by inhibiting CBY1 expression or inhibiting the CBY1 function.

The invention discloses an egg yolk protein osteogenic peptide and a preparation method thereof, and belongs to the field of biological medicine and the technical field of functional food or egg product processing. According to the method, the skimmed yolk powder is subjected to enzymolysis to prepare the osteogenic bioactive peptide, enrichment and separation are carried out through macroporous resin, the preparation and enrichment process is suitable for large-scale production, and laboratory achievements can be promoted to be converted into industrial production; two osteogenic active peptides are separated and identified, DFDLPT has the activity of promoting osteoblast proliferation, and FDIDPG has the functional activity of promoting osteoblast differentiation and mineralization.

The application discloses a flavonoid compound in eaglewood as well as a preparation method and application of the flavonoid compound, and relates to the technical field of medicines. The application extracts and separates a new compound from natural eaglewood, and the new compound is used in the preparation of anti-osteoporosis drugs. The compound is detected in vitro to obtain an induction effect of the compound on the differentiation of bone marrow mesenchymal stem cells (BMSCs) into osteoblasts, so as to affect the formation of osteoclasts. Meanwhile, the compound can promote the bone development of zebra fish through RT-qPCR detection, which indicates that the compound has anti-osteoporosis activity. The separation method of the compound is simple and easy to operate.

The invention relates to the technical field of biomedical materials, in particular to a degradable zinc-based composite GBR film with the surface loaded with a nanometer electrostatic spinning fiber coating and preparation and application of the degradable zinc-based composite GBR film. According to the degradable zinc-based composite GBR membrane with the surface loaded with the nano electrostatic spinning fiber coating, the nano fiber coating is implanted into the surface of a zinc-based material such as zinc alloy by adopting an electrostatic spinning technology, and the degradable zinc-based composite GBR membrane with the surface loaded with the nano electrostatic spinning fiber coating can inhibit excessive release of zinc ions, improve biocompatibility of the zinc alloy and the like, promote osteoblast differentiation and promote angiogenesis. The electrostatic spinning coating on the surface of the zinc-based composite GBR membrane serves as a physical barrier to block invasion of epithelial cells and fibrocytes, and angiogenesis is promoted along with degradation of fibers and slow release of drugs; the porous zinc alloy and the like in the middle layer not only provide mechanical support, but also release zinc ions in the degradation process to achieve multiple functions of resisting bacteria and promoting osteogenesis.

The present invention relates to a composition comprising 4-hexylresorcinol (4-HR) as an active ingredient for prevention or treatment of a bone disease, and a formulation thereof. The composition comprising 4-hexylresorcinol (4-HR) as an active ingredient, or an ointment thereof was found to improve bone thickness, density, and strength and control bone remodeling by promoting the differentiation of osteoblasts and suppressing the proliferation and differentiation of osteoclasts in osteoporosis-induced animal models. Thus, the composition or ointment comprising 4-hexylresorcinol (4-HR) as an active ingredient can be provided as a therapeutic agent for bone diseases including bone fracture, osteoarthritis, rheumatoid arthritis, and osteoporosis.

The invention provides application of linariin-6-O-glucoside in preparation of a product for preventing and treating osteoporosis, and relates to the field of biological medicine. According to the invention, dyeing experiments of alkaline phosphatase, alizarin red and tartaric acid resistant acid phosphatase prove that the sesaminin-6-O-glucoside has affinity for FPPS receptors, has the capability of promoting bone marrow mesenchymal stem cells to form bone cells, is superior to that of bisphosphate, and can inhibit the generation of osteoclasts; microCT (micro computed tomography) detection results show that the sesaminin-6-O-glucoside has the effect of relieving the osteoporosis and can promote the formation of bone trabecula. According to the application disclosed by the invention, it is proved for the first time that the sesaminin-6-O-glucoside has the effect of resisting osteoclast formation, and meanwhile, the sesaminin-6-O-glucoside also has a better osteogenesis effect, so that a basis is provided for developing the sesaminin-6-O-glucoside as a potential medicine for treating osteoporosis.

The invention belongs to the field of cell biology, and particularly relates to a preparation method and application of an extracellular matrix of cell-engineered human collagen. The preparation method comprises the following steps: S1, culturing human induced pluripotent stem cells or a cell culture comprising the human induced pluripotent stem cells, and directly inducing differentiation to obtain induced mesenchymal stem cells or a cell culture comprising the induced mesenchymal stem cells; and S2, carrying out 3D culture on the induced mesenchymal stem cells through a 3D porous scaffold carrier. The extracellular matrix prepared by the preparation method provided by the invention is rich in collagen, so that the mesenchymal stem cells can be better promoted to be differentiated into osteoblasts, and meanwhile, a new thought is provided for the preparation of the collagen.

To provide a novel Lactobacillus paracasei strain with bone regeneration effects, and pharmaceutical and food compositions containing the same. [Solution] The present invention relates to a novel Lactobacillus paracasei L-30 and its uses, and more particularly to Lactobacillus paracasei L-30 (KCTC16035BP) which has the ability to promote the differentiation or formation of osteoblasts, the ability to suppress the differentiation or formation of osteoclasts, and the ability to promote immune activity, and which can regenerate bone, and to a pharmaceutical composition for the treatment or prevention of bone diseases containing the same.

The present disclosure discloses a method for isolating osteoprogenitors like mesenchymal stem cells (MSCs) from clotted bone marrow and culturing with a platelet lysate obtained from a combination of discarded umbilical cord blood and maternal blood platelet-rich plasma (instead of non-human animal origin serum) and differentiating those MSCs into osteoblasts under sterile conditions for further therapeutic applications. Particularly, the present disclosure relates to a method for expansion of osteoblasts to make cell therapy products with a fixed cell dose, which are characterized and later cryopreserved for future use through its cell culture process. Further, the present disclosure relates to identifying specific gene expression from MSCs to osteoblast formation, an in-vitro differentiation process that replicates the in-vivo bone remodelling system.

The application provides an application of miR-30d-5p and CYP24A1 inhibitor in hormone-induced femoral head necrosis, and belongs to the technical field of biological medicine.The application firstly provides a hormone-induced femoral head necrosis treatment strategy based on miR-30d-5p mimic by determining the molecular mechanism of miR-30d-5p in the regulation of CYP24A1 in the vitamin D metabolic pathway, and the direct effect is to significantly promote osteoblast differentiation and bone matrix mineralization, effectively improve bone microstructure damage and delay the femoral head collapse process; in the application significance, the application provides a new solution to the predicament of the lack of targeted drug treatment in clinic, and lays a conversion foundation for conservative treatment and hip-preserving surgery combined treatment by blocking the disease progression through specific molecular intervention.

The invention discloses an application of a branched ketonic acid dehydrogenase kinase (BCKDK) inhibitor in preparation of a medicine for preventing and treating osteoporosis. The invention finds that BCKDK can inhibit osteoblast differentiation and reduce the expression of endogenous BCKDK in osteogenic precursor cells so as to promote osteoblast differentiation; a small molecule compound inhibitor BT2 (3, 6-dichloro-2-benzothiophene carboxylic acid) of BCKDK promotes osteoblast differentiation of ovariectomized mice, inhibits osteoclast differentiation, reduces ovariectomized mouse bone loss and increases bone mass. According to the invention, the BCKDK inhibitor is proposed for the first time to be capable of promoting osteoblast differentiation, inhibiting osteoclast differentiation and increasing body bone mass by reducing BCKDK expression or inhibiting BCKDK protein biological functions, and has the effect of preventing and treating osteoporosis.

This invention discloses the application of agar-agar polysaccharides in the preparation of products with bone density-improving effects. The agar-agar polysaccharides are obtained from agar-agar as raw material through acid extraction, alcohol precipitation, dialysis, and ion exchange chromatography purification, with a weight-average molecular weight range of 1500-5000 Da. This invention applies agar-agar polysaccharides to the preparation of products with bone density-improving effects, including food, health products, or pharmaceuticals; particularly, it can be used to prepare functional cereal foods. The agar-agar polysaccharides of this invention have an ameliorative effect on bone density loss in a dexamethasone-induced zebrafish osteoporosis model, can enhance the activity of alkaline phosphatase (ALP) in zebrafish, and promote osteoblast differentiation.

The invention discloses application of fructus psoraleae vesicles in preparation of a medicine for preventing and / or treating orthopedic diseases. The fructus psoraleae vesicles can promote osteoblast differentiation and proliferation, and can be used for preventing and / or treating orthopedic diseases such as osteoporosis.

The present invention provides an application of animal Bifidobacterium lactis subspecies CP-9 in the preparation of a product that promotes bone growth and development or improves bone health. After long-term research and a large number of experiments, the present invention found that animal Bifidobacterium lactis subspecies CP-9 can improve the body's bone volume fraction, trabecular thickness, bone density and bone mass, and can also effectively increase the level of growth hormone and insulin-like growth factor 1, thereby promoting bone growth and development. At the same time, animal Bifidobacterium lactis subspecies CP-9 can effectively increase the level of type I procollagen N-terminal propeptide, osteocalcin level, bone morphogenetic protein level, and osteoprotegerin level in the body, and significantly reduce the level of type I collagen amino-terminal peptide and nuclear factor κB receptor activator ligand level, thereby promoting osteoblast differentiation, inhibiting osteoclast differentiation, and then promoting bone formation, inhibiting bone resorption, improving bone metabolism, and ultimately achieving the effect of improving bone health.

The application discloses a SrCO3@ZIF-8 / polymer composite bone scaffold and a preparation method thereof, and comprises the following steps: growing zeolite imidazolate framework-8 (ZIF-8) on the surface of SrCO3 in situ to prepare SrCO3@ZIF-8 microrods, uniformly mixing the SrCO3@ZIF-8 microrods and a polymer material through grinding, and preparing the SrCO3@ZIF-8 / polymer composite bone scaffold by using a selective laser sintering technology. The SrCO3@ZIF-8 / polymer composite bone scaffold obtained by the application is applied to bone defect repair, and the Zn ions and Sr ions generated by in-vivo degradation of the scaffold can promote the differentiation of stem cells into osteoblasts, endow the scaffold with osteogenic activity, promote the polarization of macrophages into M2 type and the expression of related anti-inflammatory factors, and strengthen the anti-inflammatory performance of the scaffold. In addition, the ZIF-8 contains a large number of 2-methyl imidazole organic ligands, can form a strong interface with the molecular chain of the polymer, solves the problem of interface incompatibility between SrCO3 and the polymer, and thus improves the mechanical performance of the scaffold.

The application discloses a pea peptide mixture with calcium binding and osteogenesis promoting effects and application thereof, wherein the pea peptide mixture is derived from protein components in a by-product of pea starch extraction, is obtained through alkaline protease and papain enzymolysis and separation and purification, and is rich in aspartic acid and glutamic acid residues. The pea peptide mixture can effectively bind with calcium ions, the pea peptide mixture can promote calcium ion delivery in osteoblasts, improve alkaline phosphatase activity, and promote osteoblast differentiation, the osteogenesis promoting effect of the pea peptide mixture is related to epidermal growth factor receptor EGFR and downstream PI3K-Akt signal pathway regulation. The pea peptide mixture can improve glucocorticoid-induced zebrafish bone mass reduction, and up-regulate mRNA expression levels of ALP, EGFR, PI3K and Akt and other genes related to osteogenesis. The pea peptide mixture has both functions and nutrition, can be used for preparing products for promoting osteogenesis, improving bone mass, improving bone mass reduction and assisting in improving osteoporosis, and has a wide application prospect in the field of bone health.

The invention discloses a preparation method and application of IBFO (at) high-entropy alloy heterojunction piezoelectric hydrogel (IBHA-SAPS), and the preparation method comprises the following steps: preparing high-entropy alloy (HEA) powder through sol-gel and calcination, compounding the HEA powder with bismuth-doped bismuth ferrite (IBFO) to construct an IBFO (at) HEA heterojunction (IBHA), and finally carrying out cross-linking molding with a sodium alginate-phenylboronic acid polymer. Under ultrasonic stimulation, the piezoelectric effect of the hydrogel can synergistically enhance the sonodynamic performance and the nano-enzyme activity, and in an acidic microenvironment, efficient antibiosis and biological membrane removal can be achieved through high-intensity ultrasound; in a neutral physiological microenvironment, low-intensity ultrasound can trigger the composite material to remove active oxygen so as to relieve oxidative stress and generate an electric signal to promote osteoblast differentiation, and the composite material has good biocompatibility, injectability and intelligent responsiveness and has wide application prospects in the fields of sonodynamic therapy, tissue engineering scaffolds, infectious bone defect repair and the like.

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The invention discloses application of an ECRG4 gene in preparation of drugs for prevention, treatment, adjuvant treatment, alleviation or alleviation of bone imbalance related diseases, and relates to the technical field of biology. By overexpressing the ECRG4 gene, the effects of prevention, treatment, adjuvant therapy, alleviation or alleviation of bone imbalance related diseases are achieved, osteoblast differentiation is promoted and / or osteoclast formation is inhibited, and the overexpressed ECRG4 gene has a nucleotide sequence as shown in SEQ ID NO: 1. It is found for the first time that the ECRG4 gene can be used as an effective target for prevention, treatment, adjuvant treatment, and alleviation or alleviation of bone imbalance related diseases. Overexpression of the ECRG4 gene can effectively promote osteogenic differentiation to facilitate bone regeneration and inhibit osteoclast differentiation to facilitate bone resorption, which reveals that the ECRG4 gene has potential application in bone-related diseases, including but not limited to fracture healing, osteoporosis, osteolysis and the like, and has broad application prospects. And a new direction is provided for prevention, treatment, adjuvant treatment and alleviation or alleviation of bone imbalance related diseases.

This invention provides a bone regeneration formula based on collagen synergy and its preparation method. The formula uses low-molecular-weight collagen peptides as organic templates and forms hydroxyapatite-like nanostructures through ion-induced mineralization, achieving a tight organic-inorganic interface. The formula can regulate osteoblast differentiation and inhibit osteoclast activity, thereby improving bone density and bone tissue regeneration capacity. The preparation process adopts a low-temperature enzymatic hydrolysis and biomimetic mineralization coupling process to maintain the stability of the active structure. Experimental results show that the formula is superior to conventional formulas in terms of molecular expression, mineralization capacity, and bone metabolism regulation.

A Lactobacillus paracasei L-30 strain deposited under Accession Number KCTC16035BP has ability to promote osteoblast differentiation or formation, inhibiting osteoclast differentiation or formation, and enhancing immune activity, thereby enabling bone regeneration. A pharmaceutical composition including the Lactobacillus paracasei L-30 strain, a lysate thereof, a culture thereof, an extract thereof, and / or a fraction of the extract may be used for treating or preventing bone diseases.

The present application relates to a kind of bone-targeted trimeric protein and its preparation method and application, belong to biomedical technology field.The present application provides a kind of recombinant trimeric protein based on trimeric motif, including nuclear factor κB receptor activation factor extracellular segment, it is verified with in-vivo and in-vitro experiment with high bone targeting, possess inhibiting osteoclastogenesis and promoting osteoblast differentiation Dual control activity, it can also induce CD4 + Treg cell development, improve the bone marrow inflammatory microenvironment of osteoporosis model mice, can be used as the drug of osteoporosis, solves the problem that traditional single-function treatment drug in prior art will cause bone resorption rebound and bone loss after stopping drug, and further induces inflammation, provides new ideas and means for the research and treatment of osteoporosis, has good application prospect.

To provide a bone metabolism improver composed of a novel ingredient.SOLUTION: A feature of the present invention for solving the problem is as follows: 1) an osteoclast differentiation inhibitor containing at least one of ferulic acid, astaxanthin, α-lipoic acid, Coprinus comatus extract, Cistanche plant extract, Subgen. Cerasus extract, γ-oryzanol, plant- and / or processed plant-derived polyamine composition, and Petasites extract as an active ingredient; 2) an osteoblast differentiation promotor containing at least one of α-lipoic acid, Cistanche plant extract, and ferulic acid as an active ingredient; 3) a promoter for expression of BSPII in an osteoblast precursor containing Cistanche plant extract as an active ingredient; 4) a promoter for expression of type 1 collagen in an osteoblast precursor containing Cistanche plant extract as an active ingredient; and 5) a bone metabolism improver containing at least one agent of 1) to 4) as an active ingredient.SELECTED DRAWING: None

The invention relates to the technical field of biology, in particular to novel application of sanguinarine (SAN), a method for inducing human amniotic mesenchymal stem cells (hAMSCs) to be differentiated into osteoblasts through COX2 protein and an osteogenic induction culture medium for the inducing method, and the method can be applied to the fields of bone disease treatment drug research and development and clinical transformation. It is proved for the first time that SAN mediates hAMSCs osteogenic differentiation through COX2 protein, SAN can significantly improve expression of COX2 gene (PTGS2) in hAMSCs, the osteogenic effect of SAN can be reversed by adding a COX2 inhibitor (such as celecoxib), and direct experimental evidence is provided for'COX2 serving as a small molecule drug to promote osteogenic differentiation '.

The invention discloses application of an RUFY4 gene in promoting osteogenic differentiation of osteoblasts, and relates to the field of osteoporosis treatment. The method comprises the following steps: constructing an overexpression lentiviral vector containing RUFY4; mouse bone marrow stromal stem cells are transfected by using the RUFY4 gene, so that RUFY4 overexpressed KUSA-O cells are obtained; the osteogenic differentiation capacity of KUSA-O cells is detected through ALP dyeing and alizarin red S dyeing, and the osteogenic differentiation promoting effect of the RUFY4 is verified. Furthermore, ossification-related gene and protein expression are detected through Western blot, qRT-PCR (quantitative reverse transcription-polymerase chain reaction) and immunofluorescence, and it is clear that RUFY4 promotes osteogenic differentiation through PI3K / AKT and / Wnt / beta-catenin signal channels. Transcriptomics analysis proves that the RUFY4 has a positive regulation effect on osteoblast differentiation, bone formation and bone density recovery of osteoporosis patients are facilitated, and a new strategy is provided for osteoporosis targeted therapeutic drugs.

The invention discloses lactobacillus plantarum and application thereof in promoting bone health and regulating intestinal flora. The name of the lactobacillus plantarum is lactobacillus plantarum GXS77, the preservation number of the lactobacillus plantarum is CGMCC No.35899, and the lactobacillus plantarum is preserved in China General Microbiological Culture Collection Center (CGMCC) in No. 3, No.1 Yard, Beichen West Road, Chaoyang District, Beijing in 2025. The yield of acetic acid and the yield of butyric acid of the lactobacillus plantarum GXS77 obtained through screening are increased by 18% and 16% respectively compared with the yield of acetic acid and the yield of butyric acid of common lactobacillus plantarum, the peak calcium absorption capacity of Caco-2 cells can be increased by 12.3%, osteoblasts are differentiated, and then bone health is promoted; meanwhile, the lactobacillus plantarum GXS77 has good acid resistance, cholate resistance and a good cell adhesion effect. Therefore, the strain can be used for developing fermented food, health-care products and medicines with the effects of promoting bone health, regulating intestinal flora and the like.

The present invention relates to a group of anti-osteoporosis compounds and their applications. These compounds can upregulate OPG expression, inhibit inflammatory pathway activation, inhibit osteoclast differentiation or bone resorption, and promote osteoblast differentiation or bone formation; and have high oral bioavailability and anti-osteoporosis activity.

The invention provides a medicinal and edible composition, medicinal and edible fermentation liquor, a preparation method and application of the medicinal and edible composition and the medicinal and edible fermentation liquor in improvement of osteoporosis, and belongs to the technical field of microbial fermentation. The medicinal and edible composition comprises the following raw materials: radix astragali, rhizoma polygonati, raspberry, fructus lycii, polished round-grained rice and black bean coat. The medicinal and edible composition disclosed by the invention has the effects of invigorating spleen, replenishing qi and nourishing liver and kidney, and can promote osteoblast differentiation, reduce bone loss and enhance body energy metabolism, thereby effectively improving osteoporosis. In addition, the medicinal and edible composition disclosed by the invention is high in safety, capable of avoiding adverse reaction on a user, and beneficial to popularization. The invention also provides a medicinal and edible fermentation broth. The medicinal and edible fermentation broth comprises the following raw materials: a concentrated water extract of the medicinal and edible composition and the lactobacillus rhamnosus NKU FL1-8, the medicinal and edible homologous fermentation liquor can also effectively improve osteoporosis, and the effect of the medicinal and edible homologous fermentation liquor is superior to that of a concentrated water extract of a medicinal and edible homologous composition.