Patents
Literature
Patsnap Copilot is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Patsnap Copilot

217 results about "Abzyme" patented technology

An abzyme (from antibody and enzyme), also called catmab (from catalytic monoclonal antibody), and most often called catalytic antibody, is a monoclonal antibody with catalytic activity. Abzymes are usually raised in lab animals immunized against synthetic haptens, but some natural abzymes can be found in normal humans (anti-vasoactive intestinal peptide autoantibodies) and in patients with autoimmune diseases such as systemic lupus erythematosus, where they can bind to and hydrolyze DNA. To date abzymes display only weak, modest catalytic activity and have not proved to be of any practical use. They are, however, subjects of considerable academic interest. Studying them has yielded important insights into reaction mechanisms, enzyme structure and function, catalysis, and the immune system itself.

Diagnostic reagent kit (enzyme-linked immunosorbent assay (ELISA)) for enterovirus (EV) 71-type antibody (immune globulin M (IgM))

The invention relates to the field of biomedicine, in particular to an enzyme-linked immunization diagnostic reagent kit for detecting an enterovirus (EV) 71-type antibody (immune globulin M (IgM)), and a preparation method and application of the diagnostic reagent kit. The probability of hand-foot-and-mouth disease and severe infection (viral encephalitis, viral cerebrospinal meningitis and pulmonary edema) caused by EV71 type is relatively higher, and case fatality rate is relatively higher and can be 10 to 25 percent. The enzyme-linked immunization diagnostic reagent kit of the EV71-IgM antibody can be used for diagnosing the infection of the EV71 type. According to related documents about the detection of the EV71-IgM, EV71 virus cultures serving as indirect enzyme-linked immuno sorbent assay (ELISA) of envelope antigens has defects in such aspects as specificity, sensitivity and stability, and due to high cultivation cost and low efficiency, a large amount of virus cannot be supplied to the market. In order to overcome the defects, the invention provides the reagent kit which is used for detecting the EV71-IgM in human blood serum, required by clinical examination, simple and convenient to operate and applicable to all medical disease control departments, and the preparation method and the application of the reagent kit. The invention has the technical scheme that: firstly, the human blood serum is added into a micro-pore plate, wherein the IgM antibody is obtained by an anti-mu chain which is pre-enveloped on the micro-pore plate, and other uncombined components are washed and removed; secondly, an enzyme labeling object is added, the EV71-IgM in the obtained IgM can be combined with the specificity of an EV71 recombinant antigen which is labeled by horse radish peroxidase (HRP), and after washing, the HRP can react with substrates which are added subsequently; and finally, the aim of detecting the EV71-IgM antibody is fulfilled.
Owner:BEIJING BEIER BIOENG

Enzyme-linked immunosorbent assay (ELISA) kit for duck hepatitis virus type-I serum antibody, test method and application thereof

The invention relates to an enzyme-linked immunosorbent assay (ELISA) kit for duck hepatitis virus type-I serum antibody and relates to a test method and application of the kit. The kit comprises an enzyme label plate coated by the recombinant VP1 (virus protein) protein, a rabbit anti-duck IgY antibody marked by horseradish peroxidase, a TMB substrate colour reagent, a positive serum, a negative serum and a kit specification. In the invention, by adopting the polymerase chain reaction, the VP1 genes are amplified from the DHV-1genome and the VP1 gene-containing recombinant expression plasmid pET32a-VP1 is constructed; the plasmid is transferred to host cells BL21 (DE3), and the in-vitro expression VP1 protein is purified by a nickel column and then used as the antigen; the enzyme-linked immunosorbent assay kit is established; the positive serum is the standard positive serum of duck hepatitis virus type-I and the negative control is the standard negative serum of duck. The test kit has the advantages of strong specificity, high sensitivity, simple operation, easy large-scale popularization and application, very important application value in diagnosis of duck hepatitis virus type-I, survey of epidemiology and immunization survey and the like.
Owner:HENAN UNIV OF SCI & TECH

Preparation of soluble human selenium-containing single-chain abzyme

The invention discloses a method to prepare soluble human selenium-containing catalytic single-chain antibodies, belonging to biotechnology field. The method includes the following steps: with glutathione derivatives as target antigen, filtrating the recombinant phage display human single-chain antibody library through immune affinity selection method to obtain single-chain antibodies B3 and D8; assembling the single-chain antibodies to secretory procaryon or eucaryon expression vector; translating colon bacillus or yeast cell; expressing and purifying the single-chain antibody proteins in procaryon or eucaryon; introducing GPX catalytic group SeCys at the substrate combining sites of the antibodies through chemical mutation method or directly expressing the soluble single-chain antibody proteins which contain GPX catalytic groups at the substrate combining sites with auxotrophic colon bacillus through genetic mutation techniques to endue the antibodies with GPX catalytic activity. The method of the invention is simple and the human selenium-containing catalytic single-chain antibodies prepared with the method are of high catalytic activity; the proteins expressed by the antibodies are soluble; therefore the method is good for large-scale production and is of broad application prospect in biological pharmacy.
Owner:JILIN UNIV

Lipoprotein-related phospholipase A2 enzyme-linked immunosorbent assay (ELISA) kit and preparation method thereof

The invention discloses a lipoprotein-related phospholipase A2 enzyme-linked immunosorbent assay (ELISA) kit and a preparation method of the lipoprotein-related phospholipase A2 ELISA kit. The lipoprotein-related phospholipase A2 ELISA kit comprises standard substances, quality control substances, a coating carrier, an enzyme marker, a color-substrate solution, an analysis buffer solution and a concentrated cleaning solution. The preparation method of the lipoprotein-related phospholipase A2 ELISA kit includes the first step of preparing the lipoprotein-related phospholipase A2 standard substances and the lipoprotein-related phospholipase A2 quality control substances, the second step of preparing the carrier wrapped by lipoprotein-related phospholipase A2 antibodies, the third step of preparing the enzyme marker of the lipoprotein-related phospholipase A2 antibodies, the fourth step of preparing the analysis buffer solution, the fifth step of preparing the concentrated cleaning solution, and the sixth step of assembling the lipoprotein-related phospholipase A2 ELISA kit. The lipoprotein-related phospholipase A2 ELISA kit can be used for replacing other kits for quantitative detection of lipoprotein-related phospholipase A2, and is low in cost, easy and convenient to operate, high in sensitivity and capable of being widely popularized and used clinically on a large scale.
Owner:TIANJIN KANGERKE BIOSCI

Enzyme-linked immunosorbent assay (ELISA) based on anti-ENRA (anti-endothelin receptor A) antibody of epitope antigen peptide and application thereof in CTD-PAH (connective tissue diseases-pulmonary arterial hypertension)

InactiveCN103728454ALow costImproving the practicality of clinical testingDisease diagnosisBiological testingAmino acidPulmonary hypertension
The invention relates to an enzyme-linked immunosorbent assay (ELISA) based on anti-ENRA (anti-endothelin receptor A) antibody of epitope antigen peptide; the enzyme-linked immunosorbent assay (ELISA) can be used in clinical tests of CTD-PAH (connective tissue diseases-pulmonary arterial hypertension); four extracellular peptide fragments with different lengths are synthesized in vitro, an epitope peptide fragment in good consistency with full-length ENRA is screened, the epitope peptide fragment is artificially synthesized to use as an antigen peptide package board to establish the enzyme-linked immunosorbent assay (ELISA) based on the anti-ENRA (anti-endothelin receptor A) antibody of the epitope antigen peptide; the epitope antigen peptide is a peptide fragment comprising the following amino acid sequence: DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKIT; the enzyme-linked immunosorbent assay reduces the cost using full-length eukaryotic-expression endothelin receptor as a substrate, improves the clinical detection practicality, becomes a biomarker of CTD-PAH (especially SLE(systemic lupus erythematosus)-PAH), and provides valuable information for clinical diagnosis and treatment decisions.
Owner:吴庄民

Indirect competition enzyme linked immunoreagent kit for detecting mercury ions and manufacturing method thereof

InactiveCN103472231AHigh potencyHigh water titerMaterial analysisAbzymeAntigen
The invention relates to an indirect competition enzyme linked immunoreagent kit for detecting mercury ions and a manufacturing method of the kit. An elisa plate enveloped by mercury ion envelope antigens, mercury-ion-resisting monoclonal antibodies, elisa second antibodies, a substrate color developing solution, a stop solution, a mercury ion standard solution, a washing liquor concentrated solution and a sample treating liquid are arranged in the kit. The kit can detect the mercury irons in a trace mode, is used for detecting the mercury irons in the environment, the soil, water, foods, medicines, cosmetics and the like, and has the advantages of being rapid, easy and convenient to use, sensitive, peculiar, economical and the like. The kit is few in detection step and high in timeliness, saves detection time, reduces operation errors and can perform field detection. The kit is low in requirement for pretreating samples, simple in treatment process, not only can be used for screening the samples in large batch, but also can perform rapid detection on the samples in small batch, and not only provides technical support for environment and food safety, but also provides effective technological means for food import and export inspection, food inspection, monitoring and evaluation of environmental pollution and the like.
Owner:ZHENGZHOU UNIV

Detection kit and preparation method thereof and detection method of troponin T

The invention belongs to the technical field of in-vitro detection, and particularly relates to a detection kit and a preparation method and application thereof. The detection kit comprises a magneticseparation reagent and an enzyme-labeled reagent; the magnetic separation reagent is prepared from troponin T antibody-coated gold magnetic particles or prepared from streptavidin-coated gold magnetic particles and a biotin-labeled troponin T antibody; and the enzyme-labeled reagent is prepared from an enzyme-labeled antibody polymer, wherein the enzyme-labeled antibody polymer is prepared from at least two enzyme-labeled antibodies and carbon bridges; the carbon bridges connect any two or more, adjacent or non-adjacent enzyme-labeled antibodies, and each carbon bridge has at least two connecting loci for connecting the enzyme-labeled antibodies; and each enzyme-labeled antibody is prepared from a detection antibody and a labeling enzyme coupled to the detection antibody, and the connecting loci are connected with the detection antibodies and/or the labeling enzymes. When chemiluminescence detection is conducted, a reaction signal value of a chemiluminescence method is amplified, thesensitivity of an antigen captured by the detection reagent can be enhanced, and the detection sensitivity is improved.
Owner:深圳天辰医疗科技有限公司

III type precollagen N end peptide chemiluminescence immune analysis quantitative determination reagent kit and preparing method thereof

The invention relates to the medical field of immunoassay, more specially, the invention provides a chemiluminescent immunoassay quantitative detection kit for III-type procollagen N-terminal peptide (PIIINP) and a preparation method thereof. The kit of the invention comprises 1) III-type procollagen N-terminal peptide calibrators, 2) solid-phase vectors which are coated with III-type procollagen N-terminal peptide monoclonal antibodies, 3) enzyme markers for III-type procollagen N-terminal peptide monoclonal antibodies, 4) chemiluminescent substrates and 5) concentrated washing solution. Further, the preparation method of the kit according to the invention comprises the following steps: 1) preparing the III-type procollagen N-terminal peptide calibrators with pure III-type procollagen N-terminal peptide, 2) coating the vectors with III-type procollagen N-terminal peptide monoclonal antibodies, 3) marking the III-type procollagen N-terminal peptide monoclonal antibodies with the enzyme, 4) preparing the chemiluminescent substrates, 5) preparing the concentrated washing solution, 6) packaging the III-type procollagen N-terminal peptide calibrators, the enzyme markers, the chemiluminescent substrates and the concentrated washing solution and 7) assembling finished products. The kit of the invention has the advantages of simplicity, convenience, rapidness, sensitivity, stability and the like.
Owner:CHEMCLIN DIAGNOSTICS CO LTD

Indirect competitive enzyme linked immunosorbent assay kit for detecting chromium ions as well as preparation and detection methods thereof

The invention relates to an indirect competitive enzyme linked immunosorbent assay (elisa) kit for detecting chromium ions as well as preparation and detection methods thereof. A trivalent chromic ion envelope antigen-enveloped elisa plate, a trivalent chromic ion-resistant monoclonal antibody, a second enzyme-labeled antibody, a substrate color-developing solution, a stop solution, a trivalent chromic ion standard solution, a lotion concentrated solution and a sample processing solution are arranged in the kit. Samples are processed before detection so that Cr3<+> in the samples forms Cr<3+>-EDTA (ethylene diamine tetraacetic acid), and then the chromium ions are detected by the kit. The chromium ion enzyme linked immunosorbent assay kit can be used for detecting the trace amount of chromium ions, has the Cr<3+> detection sensitivity of 2ng / ml, has the characteristics of quickness, simplicity and convenience, sensitivity, specificity, economy and the like, has few detection steps, saves the detection time, and reduces the operation error; the detection cost is less than 1 / 20 of that of a physical and chemical analysis method, the timeliness is high, the field detection can be performed, and the kit is mainly used for screening large-batch samples of chromium ion pollution residues in environments, soil, water and foods.
Owner:HENAN INST OF SCI & TECH

Immunoassay

The invention provides a highly sensitive immunoassay for detection of a biological species. The immunoassay comprises exposing an electrode to an analyte liquid putatively containing the biological species so as to couple the biological species, if present in the analyte liquid, to a binding antibody on the electrode. The electrode comprises a binding antibody and an anchor group, each being coupled to an electrically conductive substrate, said binding antibody being capable of binding to the biological species and said anchor group being capable of binding to a redox polymer. The electrode is then exposed to an antibody-enzyme liquid comprising an antibody-enzyme species, said antibody-enzyme species comprising a detection antibody capable of binding to the biological species, said detection antibody being coupled to a redox enzyme, whereby, if the analyte liquid comprises the biological species, the redox enzyme couples to the electrode by means of the coupling of both the detection antibody and the binding antibody to the biological species. The electrode is then exposed to a polymer solution comprising the redox polymer and to an enzyme substrate, whereby if the redox enzyme is coupled to the anchor group on the electrode the redox polymer is reduced and couples to the anchor group on the electrode. A voltage is then applied between the electrode and a reference electrode and the electrode is exposed to an oxidisable species, whereby a magnitude of an electric current between said electrode and a reference electrode is indicative of the presence or absence of the biological species.
Owner:AGENCY FOR SCI TECH & RES

Method of detecting small molecule substances based on chemiluminescence immunology of golden-magnetic particles

The invention provides a method of detecting small molecule substances based on chemiluminescence immunology of golden-magnetic particles. The method mainly comprises the following steps: (1) coating: a step of using a golden-magnetic particle as carriers for immunoreaction and solid separation, using a small molecule substance corresponding to a small molecule substance to be detected to synthesize an antigen and coupling the antigen onto the surface of the golden-magnetic particle; (2) enclosing: a step of enclosing blank sites on the surface of the golden-magnetic particle which have not bound to the antigen by using blocking buffer , carrying out magnetic separation and discarding supernatant; (3) reaction with the substance to be detected: a step of adding a sample to be detected, an antibody against the small molecule substance to be detected and enzyme labeled secondary antibody capable of specifically binding to the antibody into the golden-magnetic particle which has bonded with the antigen synthesized from the small molecule substance so as to form a specific antigen-antibody-enzyme labeled secondary antibody compound; (4) cleaning and (5) detection. The detection method provided in the invention has the advantages of high sensitivity, good specificity, a wide linear range, high precision, good stability, no radioactive pollution, safe operation, simpleness and rapidity.
Owner:XIAN GOLDMAG NANOBIOTECH
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products