34 results about "Coenocyte" patented technology

The invention discloses a combined evaluation method for in-vitro and in-vivo red fading and relieving effects of cosmetic raw materials, which comprises the following steps: in-vitro model evaluation: inducing a human immortalized umbilical vein endothelial cell model by adopting TNF-alpha, and detecting the secretion amount of a prostacyclin I2 factor to obtain a score of an in-vitro model; in-vivo model evaluation: adopting a chick embryo chorioallantoic membrane model, and obtaining a score of the in-vivo model according to the degree of vasoconstriction caused by the to-be-detected raw material sample acting on the chick embryo chorioallantoic membrane; and comprehensive evaluation: based on the score of the in-vitro model and the score of the in-vivo model, comprehensively evaluating the red fading and relieving efficacy of the raw material sample to be tested. According to the technical scheme, the defect that in the prior art, no cosmetic raw material soothing efficacy evaluation method for the vascular reactivity increasing mechanism exists is overcome, efficacy evaluation is more accurate, the method has the advantages of being comprehensive, short in test period, easy to operate, economical and convenient, and an effective reference basis is provided for screening and compounding schemes of red fading and soothing raw materials.

The invention discloses application of a tripterygium wilfordii exosome in preparation of an anti-cervical cancer medicine and a tumor angiogenesis inhibiting medicine, and relates to the field of biological medicine. The medicinal plant exosome derived from tripterygium wilfordii is successfully separated, and it is proved that the medicinal plant exosome can regulate related pathways through delivery of functional nucleic acid molecules to inhibit proliferation and migration of cervical cancer cells and promote active oxygen related apoptosis so as to be used for tumor treatment. The tripterygium wilfordii exosome can further act on vascular endothelial cells in a tumor microenvironment, the migration function of Hela cells is inhibited, and then the effect of resisting cell proliferation in the tumor microenvironment is achieved. The tripterygium wilfordii exosome has the advantages of being simple in preparation method, remarkable in tumor growth resistance and tumor cell migration inhibition effect, good in biocompatibility, high in delivery efficiency and the like, and can be used as a novel nano-drug for tumor treatment.

The invention relates to the technical field of marine microorganisms, in particular to application of bifidobacterium animalis subsp. Lactis in preparation of products for improving urticaria and Alzheimer's disease, the preservation number of the bifidobacterium animalis subsp. Lactis is CCTCC NO: M 2024801, the bifidobacterium animalis subsp. Lactis is preserved in China Center for Type Culture Collection on April 25, 2024, the strain is derived from healthy baby girl feces, and the preservation number is CCTCC NO: M 2024801. After research, the inventor finds that the composition has the effects of inhibiting the growth of klebsiella pneumonia, agglutinating klebsiella pneumonia, reducing alcohol-induced injury of skin cutin barrier and inflammation, reducing alcohol-induced injury of brain microvascular barrier and inflammation, improving the klebsiella pneumonia induced injury survival rate of brain microvascular endothelial cells and improving the activity of the brain microvascular endothelial cells. Klebsiella pneumonia induced damage to brain microvascular barriers and inflammation is reduced, and Klebsiella pneumonia induced damage to intestinal barriers and inflammation is reduced. The compound can be used for preparing products for improving urticaria and Alzheimer's disease.

The present invention relates to lipid nanoparticle (LNP) compositions, as well as diagnostic or therapeutic polynucleotides, such as TERT mRNA, that can be delivered in a formulation together with the LNP compositions to various tissue and cell types in the whole body of a mammal, such as, for example, TNP mRNA. Comprising stem cells, progenitor cells, germ cells, differentiated cells or terminally differentiated cells, cancer cells, endothelial cells, epithelial cells, splenic cells, hepatocells, kidney cells and / or osteoblasts, for example, for use in the diagnosis, prevention and / or treatment of a condition or disease.

This invention discloses a biomimetic nanocomposite, its preparation method, and its application in the preparation of products for treating atherosclerosis, belonging to the field of pharmaceutical preparation technology. The biomimetic nanocomposite is an Ir-TiO2 metal nanozyme encapsulated in an M2 macrophage membrane. This invention prepares a structurally biomimetic nanocomposite by coating Ir-TiO2 nanoparticles with an M2 macrophage membrane. After intravenous injection, the formed biomimetic nanocomposite actively targets endothelial cells in atherosclerotic lesions, releasing Ir-TiO2 antagonistically into the cytoplasm of plaque-containing endothelial cells and inflammatory macrophages. Once Ir-TiO2 reaches the lesion site, it exerts an enzymatic effect to achieve anti-inflammatory activity and promotes cholesterol excretion from inflammatory cells such as macrophages and smooth muscle cells at the lesion site, reducing intracellular lipid deposition, reducing foam cell formation, and promoting plaque growth. This nanotherapy can effectively prevent the progression of inflammation in atherosclerotic lesions and alleviate atherosclerosis.

Disclosed are use of a circRNA molecule as a diagnostic marker in a cell senescence diagnosis kit, and use thereof as a treatment target for cell senescence. The present invention finds that circHERC1 is lowly expressed in both cell models of natural senescence and induced senescence. Overexpression of circHERC1 in endothelial cells can improve the proliferation capacity of the endothelial cells, effectively extend the telomere length of the cells, activate telomerase, reduce the β-galactosidase positive rate of the cells, and reduce the expression of all senescence-associated proteins. Introduction of exogenous circHERC1 into mice can effectively delay the senescence of various organs and the shortening of telomeres in aged mice and reduce the β-galactosidase positive rates of various organs of aged mice.

The invention discloses a cell single-molecule mechanical force sensor for single-molecule mechanical force detection in a cell phagocytosis process as well as a preparation method and application of the cell single-molecule mechanical force sensor. The sensor comprises a microsphere substrate and a plurality of double-stranded DNA mechanical probes modified on the surface of the microsphere substrate, the probe is composed of a first single-stranded DNA and a partially complementary second single-stranded DNA and forms an FRET or fluorescence quenching pair, when a pulling force applied to the probe by a receptor-ligand effect exceeds a preset melting threshold value in a process of swallowing or wrapping microspheres by a cell, the double-stranded DNA generates melting or conformational change and generates fluorescence signal change, and the fluorescence signal change is detected by the first single-stranded DNA and the partially complementary second single-stranded DNA. Therefore, the detection of the monomolecular mechanical force of the phagocytic interface is realized. By adjusting the geometric conformation and sequence design of the probe, a probe library with different melting force thresholds can be constructed, and quantitative analysis and spatial distribution characterization of mechanical force in the phagocytosis process are realized. According to the application, a three-dimensional phagocytic interface can be truly simulated, and an effective tool is provided for revealing a mechanism for regulating and controlling endothelial cell phagocytic behaviors through blood flow mechanics and screening related disease drugs.

The invention provides a traditional Chinese medicine composition with functions of softening hardness and dredging collaterals as well as a preparation method and application of the traditional Chinese medicine composition. The traditional Chinese medicine composition with the functions of softening hardness and dredging collaterals is prepared from the following raw material medicines in parts by weight: 20-40 parts of turtle shells, 20-40 parts of radix paeoniae alba, 14-22 parts of sedum sarmentosum, 9-21 parts of teasel roots, 9-21 parts of rhizoma acori graminei, 9-21 parts of astragalus membranaceus, 14-22 parts of ligusticum wallichii and 3-15g of honey-fried licorice roots. The traditional Chinese medicine composition has the advantages that the traditional Chinese medicine composition adopts a treatment method of softening hardness to dissipate stagnation, dredging collaterals and relieving spasm, and can improve clinical symptoms such as cognitive impairment related to small cerebral vasculopathy of a patient, and / or anxiety and depression, and / or sleep disorder and the like. In-vitro experiments prove that the traditional Chinese medicine composition has a protection effect on human brain microvascular endothelial cell injury caused by hypoxia and reoxygenation, and can promote cell proliferation and inhibit cell apoptosis. Therefore, the traditional Chinese medicine composition can be applied to prevention and / or treatment of clinical symptoms related to small cerebral vasculopathy under the pathological mechanism of pulse stagnation and collateral arthralgia.

The application discloses a new use of androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione, namely, application of the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione in preparation of a medicine for treating lymphoma. 50 The IC value of the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione in the SR cell line is detected by a CCK-8 method, and the cytotoxicity of the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione on human umbilical vein endothelial cells Huvce and human immortalized keratinocytes Hacat is detected, in the body, the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione significantly inhibits tumor growth and shows good biological safety and no systemic toxicity; TUNEL staining, gamma-H2AX staining and neutral comet experiment prove that the compound of the application inhibits the growth of SR by causing serious damage to DNA, the application not only adds the diversity of the biological activity of the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione, but also provides a new direction for developing a new medicine for treating lymphoma.

The application discloses a polypeptide for targeting antagonizing pCAV1 and application thereof, and relates to the technical field of biology.The polypeptide is any one of the amino acid sequences shown in (1) and (2): (1) has the amino acid sequence shown in SEQ ID NO:1: VHPKQHRGGSKGCGGYGRKKRRQRRRGGFIYVNQSFAPK; and has the amino acid sequence shown in SEQ ID NO:1, and a polypeptide derivative obtained by modifying, substituting or adding one or more amino acid sites in the amino acid sequence.The application first excavates an antagonistic short peptide (namely CBM polypeptide) which can target p-caveolin-1 (pCAV1), can specifically block the combination of pCAV1 and ATG12-ATG5 compound to activate the autophagy process of endothelial cells, and can reduce the amount of low-density lipoprotein (LDL) crossing the endothelial cells, and it is proved that the polypeptide can effectively delay the progress of early atherosclerotic plaques.

The invention belongs to the technical field of biology, and particularly relates to an in-situ spray polymerization coating started by bacterial exovesicles (LBEVs) as well as a preparation method and application of the in-situ spray polymerization coating. And functionalizing the LBEVs by Fe < 3 + > through electrostatic adsorption to obtain an LBEVs-Fe < 3 + > solution. After LBEVs-Fe < 3 + > and pyrrole monomers are sprayed on a wound part, the LBEVs-Fe < 3 + > initiates pyrrole to be oxidized and polymerized into polypyrrole, and a polymerized coating LBEVs-PPy is formed. The LBEVs show effective antibacterial activity on staphylococcus aureus, escherichia coli and staphylococcus epidermidis, near-infrared triggered photo-thermal activation generates mild thermal therapy, expression of angiogenesis regulatory factors (such as VEGFA and ANGPT1) in human umbilical vein endothelial cells (HUVECs) is remarkably up-regulated, and an HSP90 / p-eNOS pathway is activated to accelerate angiogenesis, so that the activity of the LBEVs is improved. The LBEVs-PPy coating remarkably accelerates wound healing through a synergistic mechanism integrating the strong antibacterial activity of LBEVs and the efficient photo-thermal characteristic of PPy.

The invention relates to a circular non-coding RNA (Ribonucleic Acid) sno-circCNOT1 and application thereof, and belongs to the technical field of medicine. The invention provides a circular non-coding RNA (Ribonucleic Acid), the nucleotide sequence of the circular non-coding RNA is shown as SEQ ID NO: 1, and the circular non-coding RNA is named as sno-circCNOT1. The invention identifies a novel snoRNA-like annular non-coding RNA, the novel snoRNA-like annular non-coding RNA is named as sno-circCNOT1, the expression of the novel snoRNA-like annular non-coding RNA is adjusted by shear force, and the novel snoRNA-like annular non-coding RNA can promote NLRP3-dependent inflammatory response and pyroptosis of endothelial cells by combining nucleofibrin and stabilizing METTL14 protein, thereby aggravating blood flow shear force and atherosclerosis induced by high fat diet. Therefore, the compound can be used as a target for relieving inflammatory response and pyroptosis of endothelial cells and treating atherosclerosis.

The invention discloses a construction method and application of an adeno-associated virus vector of a targeted vascular endothelial cell, and belongs to the technical field of genetic engineering. The construction method and the application comprise the following steps: S1, vector construction: cloning a Tie2-eNOS promoter to a pAAV-MCS plasmid, so as to obtain pAAV-Tie2-MCS; the preparation method comprises the following steps: carrying out PCR (Polymerase Chain Reaction) amplification on a VEGF (Vascular Endothelial Growth Factor) gene, and inserting the VEGF gene into a pAAV-MCS plasmid to obtain an expression plasmid pAAV-Tie2- The method comprises the following steps: carrying out combined mutation on a VP1 gene of a pAAV-RC6 plasmid to obtain a mutant plasmid pAAV-RC6; s2, virus packaging and purification: culturing an HEK293 cell, and transfecting a pAAV-Tie2-VEGF (Vascular Endothelial Growth Factor), a mutant plasmid pAAV-RC6 and a pHelper plasmid; performing chromatographic purification by combining iodixanol gradient centrifugation with Heparin, so as to obtain rAAV; and S3, carrying out titer determination, SDS-PAGE (Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis) and in vitro and in vivo experiment detection on the rAAV. The preparation process is simple, the titer greater than or equal to 1 * 10 < 13 > vg / mL can be obtained through single transfection, and the production cost is reduced; and mutation screening is realized through a directed evolution technology, so that the experimental period is shortened. And the vector provided by the invention has relatively high specificity on vascular endothelial cells.

Sickle cell disease (SCD) is a single gene disorder characterized by mutant hemoglobin-S (HbS) and chronic intravascular haemolysis. Painful vaso-occlusive crises (VOC) are typical of SCD and often associated to a further rise in hemolysis. VOC is the clinically painful form of vaso-occlusion, that is due to the aggregation of red blood cells in the capillaries and venules. Such event is promoted or aggravated by adhesion of polymorphonuclear neutrophils (PMNs) to red blood cells and the endothelium leading to tissue ischemia, inflammation and imperfect repair. Repeated vaso-occlusion and PMNs interactions with the vascular endothelium are thought to promote microvascular injuries in SCD patients. The inventors tested the effect of pharmacological inhibition of TREM-1 with LR12 peptide in two experimental vaso-occlusive crisis models. Additional validation of TREM-1 involvement in vaso-occlusion was verified using mice with sickle cell disease and Trem-1 gene deficiency. In particular, the inventors showed that TREM-1 inhibition is particular suitable for limiting the severity of vaso-occlusions. The results obtained by the inventors also suggest that plasmatic concentration of sTREM-1 could be a reliable biomarker for predicting vaso-occlusions and / or SCD-associated organ dysfunction and end-organ damage.

The invention belongs to the field of medicine application, and particularly relates to application of polygonum multiflorum and an extract thereof in preparation of a medicine for repairing diabetic wounds. Cell experiments show that the polygonum multiflorum ethanol extract has remarkable in-vitro antioxidant activity and good cell safety, and can effectively enhance proliferation, migration, apoptosis resistance and oxidative stress resistance of human umbilical vein endothelial cells in a high-glucose environment by activating a P62-Keap1-Nrf2 signal channel. Animal experiments further prove that the extracting solution can remarkably accelerate wound healing of diabetic mice, relieve local inflammation infiltration, increase the collagen content, promote transformation of the diabetic mice to mature collagen and reduce the oxidative stress level of tissues at the same time. The treatment effect of the radix polygoni multiflori is equivalent to that of a clinical common drug basic fibroblast growth factor, and the radix polygoni multiflori has a wide application prospect in the aspect of wound repair of diabetes mellitus.

The application provides a nucleic acid molecule, a pro-angiogenic mesenchymal stromal cell and application thereof, relates to the biomedical technical field, and the nucleic acid molecule encodes HGF protein, or encodes VEGF165 protein and HGF protein; a first signal peptide is used as the signal peptide of the VEGF165 protein, and a second signal peptide is used as the signal peptide of the HGF protein. Through a gene modification strategy, MSC cells containing the nucleic acid molecule can stably and efficiently express VEGF165 and / or HGF, and the expression amount is significantly higher than that of MSC without the nucleic acid molecule. The cells have the ability to promote the migration of endothelial cells; meanwhile, the cells can also significantly promote the proliferation and tube formation of HUVEC cells, and further confirm the strong pro-angiogenic effect. The technical problem that nucleic acid molecules expressing VEGF165 or / HGF cannot be stably and efficiently expressed in the prior art is solved.

The application discloses a method for conditionally inducing in zebra fish for researching kdrl (vegfr2) gene in blood vessel growth research, which comprises the following steps: (1) preparing a kdrl conditional knock-out strain by using non-homologous end connection; (2) crossing a transgenic strain for marking blood vessel endothelial cells with the kdrl conditional knock-out strain to establish a double-transgenic strain; and (3) injecting Cre mRNA into embryos generated by crossing the double-transgenic strain to realize kdrl knock-out, and observing and evaluating the abnormality of blood vessel growth through fluorescence.

The application discloses a cell monomolecular mechanical force sensor for detecting a cell phagocytosis process, a preparation method and application thereof, and the sensor comprises a microsphere substrate and a plurality of double-stranded DNA mechanical probes modified on the surface of the microsphere substrate; the probes are composed of a first single-stranded DNA and a partially complementary second single-stranded DNA, and form a FRET or fluorescence quenching pair; when a cell exerts a pulling force on the probes through receptor-ligand interaction during phagocytosis or wrapping of the microsphere and the pulling force exceeds a preset melting threshold, the double-stranded DNA is melted or conformationally changed and a fluorescence signal change is generated, so that detection of a single-molecule level mechanical force at a phagocytosis interface is realized. By adjusting a geometric conformation and sequence design of the probes, a probe library with different melting force thresholds can be constructed, quantitative analysis and spatial distribution characterization of mechanical forces during phagocytosis are realized. The application can truly simulate a three-dimensional phagocytosis interface, and provides an effective tool for revealing a mechanism of blood flow mechanics regulating endothelial cell phagocytosis behavior and drug screening related to diseases.

The invention relates to a microparticle comprising a core and a membrane surrounding the core, wherein the membrane comprises a cell membrane component. A method for transporting the microparticle is provided. The transport method comprises administering the microparticle to an endothelium, whereby the microparticle is bound to the endothelium; and moving the microparticle across the endothelium. Also provided is a method for preparing the microparticle.

The receptor for advanced glycation end-products (RAGE) is a multi-ligand receptor member of the immunoglobulin super family which is able to bind Aβ peptide and 3-sheet fibrils. It is expressed in endothelial cells, smooth muscle cells, microglia and neurons, and is implicated in the transport of Aβ through the blood-brain barrier (BBB), oxidative stress-mediated neurotoxicity, and adverse microglia inflammatory responses. The interaction between RAGE and its ligands is thought to result in pro-inflammatory gene activation. Enhanced levels of RAGE ligands in Alzheimer's disease are thought to contribute to the cause of this disorder. Embodiments of the invention use the RAGE multi-ligand site as an anchoring loci for a conversion electron emitting compound rather than as a receptor to intrinsically activate or block inflammation through the RAGE intracellular cascade through activation of the RAGE cytoplasmic tail (ctRAGE) and mammalian diaphanous 1 (DIAPH1).

This invention relates to the field of animal model construction technology, and more particularly to a method for constructing a zebrafish coronary artery microcirculation injury model based on enzyme stripping and its application. This invention, for the first time, utilizes a rationally composed mixture of collagenases to specifically strip coronary artery endothelial cells, minimizing non-specific damage to cardiomyocytes and stably inducing coronary artery injury to construct a zebrafish model of coronary artery injury, particularly coronary artery microcirculation injury. This model not only has a highly localized injury area and minimal impact on the myocardium, but also exhibits a low mortality rate. Furthermore, the zebrafish model of coronary artery injury constructed by this invention demonstrates significant regenerative potential, with its blood vessels exhibiting strong regenerative capacity. It also shows high sensitivity and responsiveness to drugs, making it potentially valuable in drug screening and mechanism research.

The present invention provides cell trait assay techniques which identify cultured human corneal endothelial cells that, in a clinical trial, have been confirmed to express early-stage clinical effects and provide clinical effects that are stable in the long term. Provided is a method for producing functional human corneal endothelial cells which can bring about human corneal function when injected into the anterior chamber of a human eye, said method including a step for growing and / or differentiating / maturing corneal endothelium precursor cells under culturing conditions that can minimize culturing stress such as growth stress. Also provided are functional human corneal endothelial cells which have been found to express a functional protein leading to corneal endothelium (cell) functional characteristics that improve corneal clouding and hydration swelling, and, as a result, sustainably maintain corneal endothelium tissue cell density in the long term and lead to eyesight improvement, or in which proteins that inhibit such corneal endothelium (cell) functional characteristics are have not been elicited or are reduced.

The application discloses a combined evaluation method for the in-vitro and in-vivo redness-reducing soothing effect of a cosmetic raw material, which comprises in-vitro model evaluation, adoption of a human immortalized umbilical vein endothelial cell model induced by TNF-alpha, acquisition of the in-vitro model score by detecting the secretion amount of prostacyclin I2 factor, in-vivo model evaluation, adoption of a chicken embryo chorioallantoic membrane model, acquisition of the in-vivo model score by the degree of blood vessel contraction caused by the action of the sample to be tested on the chicken embryo chorioallantoic membrane, and comprehensive evaluation of the redness-reducing soothing effect of the sample to be tested based on the in-vitro model score and the in-vivo model score. The technical scheme of the application makes up for the defect of the prior art that there is no cosmetic raw material soothing effect evaluation method for the mechanism of increased vascular reactivity, the effect evaluation is more accurate, and the method has the advantages of comprehensiveness, short test cycle, simple operation, economy and convenience, and provides an effective reference for the screening and compounding scheme of redness-reducing soothing raw materials.

The present disclosure provides: a method for washing corneal endothelial cells; and a method for producing a corneal endothelial cell preparation. In one aspect, the present disclosure provides a method for producing a corneal endothelial cell preparation, the method comprising a step for washing a corneal endothelial cell or a corneal endothelium-like cell with a solution containing about 0.01% by weight to about 10% by weight of a protein and a step for mixing the corneal endothelial cell or the corneal endothelium-like cell with a composition for preparation production use to produce a corneal endothelial preparation, in which the protein is selected from the group consisting of human serum albumin, casein, lactoferrin, ovalbumin, and combinations thereof.

Inventors show that both iKO and Eng+ / - experienced increased bleeding compared to WT mice (longer bleeding times, more rebleeding events, greater hemoglobin loss, p<0.05). Treatment with pEng effectively reduced bleeding in all genotypes (p<0.05), reverting to the control WT condition. Furthermore, pEng induced strong platelet aggregation in both murine and human platelets compared to controls (p<0.01), demonstrating its efficacy in promoting hemostasis. No differences were found in term of co-culture, wound healing and sprouting considering controls and endoglin siRNA ECs, while a beneficial effect on ENG-free endothelial cells was found in capillary flow conditions, restoring the control condition. Accordingly, pEng appears to be a promising treatment for epistaxis in HHT, without deleterious effect on EC tested functions. The present invention relates to a peptide derived from endoglin (pEng) comprising at least the amino acid sequence X1-X2-X3-X4-X5-X6-X7-X8-X9-X10 (SEQ ID NO: 1) wherein X1 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X2 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X3 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X4 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X5 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X6 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X7 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X8 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X9 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), X10 is Phe (F), Tyr(Y), His(H), Thr(T), Ser(S), Leu(L), or Val (V), Wherein peptide derived from endoglin (pEng) comprises at least one of each Phe(F), Leu(L), Tyr(Y), His(H), Thr(T), Ser(S), and Val(V).

The invention belongs to the technical field of cell culture, and particularly relates to a microvascular endothelial cell culture method and application thereof. A culture solution used in the culture method comprises a basic culture medium, fetal calf serum, HEPES, Glutamax, N2, G-5, B-27, hEGF and antibiotics, wherein the basic culture medium is formed by mixing DMEM (Dulbecco Modified Eagle Medium) and MCDB 131 in a ratio of 1: 1. According to the culture solution, by optimizing the components and the proportion thereof, the in-vitro proliferation rate of HMEC-1 cells can be remarkably promoted, and the high-activity state and normal functional characteristics of the cells in the long-term culture process are effectively maintained; the technical problems that the cell proliferation efficiency is low and the cell activity and function are difficult to maintain in a long-term culture state in an existing culture method are solved. The culture system provided by the invention is clear in component and simple and convenient to operate, and a stable and reliable technical platform is provided for related research of the microvascular endothelial cells.

The application provides a method for constructing a hemangioma animal model, and belongs to the field of animal models. The method is to inject hemangioma endothelial cells and hemangioma pericytes into subcutaneous tissues of an animal, and to obtain a hemangioma animal model after 5-30 days. The application successfully constructs a hemangioma animal model based on hemangioma endothelial cells and hemangioma pericytes, the hemangioma animal model has a short construction time, consistent pathological characteristics with those of hemangioma, and can simulate the characteristics of in-vivo hemangioma from proliferation to regression evolution, thereby providing an important animal model carrier platform for in-vitro mechanism research of hemangioma and screening of new targeted drugs.

The application provides a construction method of an acute low-perfusion animal model and application thereof, and relates to the technical field of biomedicine. The construction method of the acute low-perfusion animal model of the application is aimed at brain capillary endothelial cells, and the animal model constructed is globally and durably low-perfused in brain microvessels, and the animal model has no infection or death risk and low cost. The animal model constructed by the application has important significance for researching the molecular mechanism of central nervous system injury caused by acute cerebral ischemia and developing a stroke treatment method.

This invention belongs to the field of biotechnology, specifically relating to an in-situ spray-polymerized coating initiated by bacterial extravesicles (LBEVs), its preparation method, and its application. LBEVs are electrostatically adsorbed by Fe... 3+ Functionalization yields LBEVs-Fe 3+ Solution. Spray LBEVs-Fe onto the wound site. 3+ After reacting with pyrrole monomers, LBEVs-Fe 3+ The process initiates the oxidative polymerization of pyrrole to form polypyrrole, resulting in a polymeric coating LBEVs-PPy. The LBEVs of this invention exhibit effective antibacterial activity against Staphylococcus aureus, Escherichia coli, and Staphylococcus epidermidis. Near-infrared triggered photothermal activation produces mild thermotherapy, significantly upregulating the expression of angiogenesis regulators (such as VEGFA and ANGPT1) in human umbilical vein endothelial cells (HUVECs) and activating the HSP90 / p-eNOS pathway to accelerate angiogenesis. The LBEVs-PPy coating significantly accelerates wound healing through a synergistic mechanism integrating the potent antibacterial activity of LBEVs and the highly efficient photothermal properties of PPy.

The present invention relates to a method of inducing differentiation of stem cells into corneal endothelial cells and use thereof. The method according to an aspect may increase, by using a composition for differentiation, the efficiency of differentiating stem cells into corneal endothelial cells. The differentiated corneal endothelial cells exhibit specific characteristics of corneal endothelial cells, and thus can be widely used as an alternative cell source for transplantation of corneal endothelial cells. Additionally, since FBS is not contained, stability in clinical trials may be improved.