48 results about "Coenocyte" patented technology

The invention discloses a combined evaluation method for in-vitro and in-vivo red fading and relieving effects of cosmetic raw materials, which comprises the following steps: in-vitro model evaluation: inducing a human immortalized umbilical vein endothelial cell model by adopting TNF-alpha, and detecting the secretion amount of a prostacyclin I2 factor to obtain a score of an in-vitro model; in-vivo model evaluation: adopting a chick embryo chorioallantoic membrane model, and obtaining a score of the in-vivo model according to the degree of vasoconstriction caused by the to-be-detected raw material sample acting on the chick embryo chorioallantoic membrane; and comprehensive evaluation: based on the score of the in-vitro model and the score of the in-vivo model, comprehensively evaluating the red fading and relieving efficacy of the raw material sample to be tested. According to the technical scheme, the defect that in the prior art, no cosmetic raw material soothing efficacy evaluation method for the vascular reactivity increasing mechanism exists is overcome, efficacy evaluation is more accurate, the method has the advantages of being comprehensive, short in test period, easy to operate, economical and convenient, and an effective reference basis is provided for screening and compounding schemes of red fading and soothing raw materials.

The invention discloses application of a tripterygium wilfordii exosome in preparation of an anti-cervical cancer medicine and a tumor angiogenesis inhibiting medicine, and relates to the field of biological medicine. The medicinal plant exosome derived from tripterygium wilfordii is successfully separated, and it is proved that the medicinal plant exosome can regulate related pathways through delivery of functional nucleic acid molecules to inhibit proliferation and migration of cervical cancer cells and promote active oxygen related apoptosis so as to be used for tumor treatment. The tripterygium wilfordii exosome can further act on vascular endothelial cells in a tumor microenvironment, the migration function of Hela cells is inhibited, and then the effect of resisting cell proliferation in the tumor microenvironment is achieved. The tripterygium wilfordii exosome has the advantages of being simple in preparation method, remarkable in tumor growth resistance and tumor cell migration inhibition effect, good in biocompatibility, high in delivery efficiency and the like, and can be used as a novel nano-drug for tumor treatment.

The invention relates to the technical field of marine microorganisms, in particular to application of bifidobacterium animalis subsp. Lactis in preparation of products for improving urticaria and Alzheimer's disease, the preservation number of the bifidobacterium animalis subsp. Lactis is CCTCC NO: M 2024801, the bifidobacterium animalis subsp. Lactis is preserved in China Center for Type Culture Collection on April 25, 2024, the strain is derived from healthy baby girl feces, and the preservation number is CCTCC NO: M 2024801. After research, the inventor finds that the composition has the effects of inhibiting the growth of klebsiella pneumonia, agglutinating klebsiella pneumonia, reducing alcohol-induced injury of skin cutin barrier and inflammation, reducing alcohol-induced injury of brain microvascular barrier and inflammation, improving the klebsiella pneumonia induced injury survival rate of brain microvascular endothelial cells and improving the activity of the brain microvascular endothelial cells. Klebsiella pneumonia induced damage to brain microvascular barriers and inflammation is reduced, and Klebsiella pneumonia induced damage to intestinal barriers and inflammation is reduced. The compound can be used for preparing products for improving urticaria and Alzheimer's disease.

The present invention relates to lipid nanoparticle (LNP) compositions, as well as diagnostic or therapeutic polynucleotides, such as TERT mRNA, that can be delivered in a formulation together with the LNP compositions to various tissue and cell types in the whole body of a mammal, such as, for example, TNP mRNA. Comprising stem cells, progenitor cells, germ cells, differentiated cells or terminally differentiated cells, cancer cells, endothelial cells, epithelial cells, splenic cells, hepatocells, kidney cells and / or osteoblasts, for example, for use in the diagnosis, prevention and / or treatment of a condition or disease.

The invention discloses multifunctional double-drug co-loaded nanoparticles as well as a preparation method and application thereof, and belongs to the technical field of medicines. A Janus nano material composed of mesoporous silica and mesoporous polydopamine is respectively loaded with salvianolic acid B and polymyxin B under the condition of pH 4.5 to obtain the double-drug co-loaded nano-particles, the double-drug co-loaded nano-particles have good biocompatibility and synergistic treatment effect, and the double-drug co-loaded nano-particles can reduce active oxygen accumulation and inhibit oxidative stress and inflammatory response, so that the double-drug co-loaded nano-particles can be used for preparing the anti-inflammatory drug for treating the salvianolic acid B and the polymyxin B. The endothelial injury caused by sepsis is effectively relieved. The salvianolic acid B and the polymyxin B are loaded at the same time, the salvianolic acid B protects endothelial cells by removing active oxygen and reducing inflammatory reaction, the polymyxin B kills gram-negative bacteria by destroying bacterial cell membranes and reduces infection sources and endotoxin release, and through the synergistic effect of the salvianolic acid B and the polymyxin B, the blood vessel leakage can be reduced, and the blood vessel leakage can be reduced. And the integrity of the endothelial barrier can be enhanced, so that the aim of treating sepsis endothelial injury is fulfilled.

The present invention provides a cell population and a method for obtaining the same. The cell population of the present invention is obtained by culturing mononuclear cells derived from bone marrow, umbilical cord blood or peripheral blood in a culture medium containing four or less factors selected from stem cell factor, interleukin 6, FMS-like tyrosine kinase 3 ligand, thrombopoietin and vascular endothelial cell growth factor, and serum.

This invention discloses a biomimetic nanocomposite, its preparation method, and its application in the preparation of products for treating atherosclerosis, belonging to the field of pharmaceutical preparation technology. The biomimetic nanocomposite is an Ir-TiO2 metal nanozyme encapsulated in an M2 macrophage membrane. This invention prepares a structurally biomimetic nanocomposite by coating Ir-TiO2 nanoparticles with an M2 macrophage membrane. After intravenous injection, the formed biomimetic nanocomposite actively targets endothelial cells in atherosclerotic lesions, releasing Ir-TiO2 antagonistically into the cytoplasm of plaque-containing endothelial cells and inflammatory macrophages. Once Ir-TiO2 reaches the lesion site, it exerts an enzymatic effect to achieve anti-inflammatory activity and promotes cholesterol excretion from inflammatory cells such as macrophages and smooth muscle cells at the lesion site, reducing intracellular lipid deposition, reducing foam cell formation, and promoting plaque growth. This nanotherapy can effectively prevent the progression of inflammation in atherosclerotic lesions and alleviate atherosclerosis.

The invention relates to hypoxia response therapeutic VEGFA (vascular endothelial growth factor A) mRNA (messenger Ribonucleic Acid) and application thereof. The mRNA comprises a 5'end cap, a 5 'UTR (Untranslated Region) containing a Kozak sequence, VEGFA ORF (Open Region Fragment), a 3' UTR containing an RNA (Ribonucleic Acid) binding protein HuR binding site, a RhoBAST fluorescent aptamer at the tail end of the 3 'UTR and a PolyA tail. According to the design, through a HuR hypoxia-dependent nuclear plasma transport mechanism, the stability of mRNA in hypoxic cells is improved by 2.5 times, the protein expression quantity is improved by 2 times, and proliferation of endothelial cells is remarkably promoted. Further disclosed is a VEGFA mRNA delivery system based on engineered extracellular vesicles (EVs): EVs surface modified kidney targeting peptide LTH. The system is efficiently accumulated in ischemic kidneys, VEGFA expression is remarkably enhanced, and abnormal vascular hyperplasia of external renal organs is avoided. Animal experiments prove that the survival rate of a renal ischemia-reperfusion injury model can be increased to 100% by intravenous injection of drug-loaded EVs, and the capillary density is remarkably increased 7 days after treatment. The invention is suitable for treating ischemic diseases, organ ischemia reperfusion injury or chronic wounds and the like, and has the advantages of accurate targeting, hypoxia response, high stability and safety.

The invention relates to the technical field of biomedicine, in particular to a piglet weaning diarrhea in-vitro multicellular co-culture model as well as a preparation method and application thereof, and the piglet weaning diarrhea in-vitro multicellular co-culture model provided by the invention is obtained by co-culturing small intestine endothelial cells and IPEC-J2 cells and inducing through an inflammatory factor inducer. The piglet weaning diarrhea in-vitro multi-cell co-culture model provided by the invention solves the problems of incomprehensiveness of a single-cell model and heterogeneity and heterogeneity of an existing model, establishes a cell model closer to the physiological status of intestinal tracts, and is of great significance to research on piglet weaning diarrhea.

Disclosed are use of a circRNA molecule as a diagnostic marker in a cell senescence diagnosis kit, and use thereof as a treatment target for cell senescence. The present invention finds that circHERC1 is lowly expressed in both cell models of natural senescence and induced senescence. Overexpression of circHERC1 in endothelial cells can improve the proliferation capacity of the endothelial cells, effectively extend the telomere length of the cells, activate telomerase, reduce the β-galactosidase positive rate of the cells, and reduce the expression of all senescence-associated proteins. Introduction of exogenous circHERC1 into mice can effectively delay the senescence of various organs and the shortening of telomeres in aged mice and reduce the β-galactosidase positive rates of various organs of aged mice.

The invention discloses a cell single-molecule mechanical force sensor for single-molecule mechanical force detection in a cell phagocytosis process as well as a preparation method and application of the cell single-molecule mechanical force sensor. The sensor comprises a microsphere substrate and a plurality of double-stranded DNA mechanical probes modified on the surface of the microsphere substrate, the probe is composed of a first single-stranded DNA and a partially complementary second single-stranded DNA and forms an FRET or fluorescence quenching pair, when a pulling force applied to the probe by a receptor-ligand effect exceeds a preset melting threshold value in a process of swallowing or wrapping microspheres by a cell, the double-stranded DNA generates melting or conformational change and generates fluorescence signal change, and the fluorescence signal change is detected by the first single-stranded DNA and the partially complementary second single-stranded DNA. Therefore, the detection of the monomolecular mechanical force of the phagocytic interface is realized. By adjusting the geometric conformation and sequence design of the probe, a probe library with different melting force thresholds can be constructed, and quantitative analysis and spatial distribution characterization of mechanical force in the phagocytosis process are realized. According to the application, a three-dimensional phagocytic interface can be truly simulated, and an effective tool is provided for revealing a mechanism for regulating and controlling endothelial cell phagocytic behaviors through blood flow mechanics and screening related disease drugs.

The invention provides a traditional Chinese medicine composition with functions of softening hardness and dredging collaterals as well as a preparation method and application of the traditional Chinese medicine composition. The traditional Chinese medicine composition with the functions of softening hardness and dredging collaterals is prepared from the following raw material medicines in parts by weight: 20-40 parts of turtle shells, 20-40 parts of radix paeoniae alba, 14-22 parts of sedum sarmentosum, 9-21 parts of teasel roots, 9-21 parts of rhizoma acori graminei, 9-21 parts of astragalus membranaceus, 14-22 parts of ligusticum wallichii and 3-15g of honey-fried licorice roots. The traditional Chinese medicine composition has the advantages that the traditional Chinese medicine composition adopts a treatment method of softening hardness to dissipate stagnation, dredging collaterals and relieving spasm, and can improve clinical symptoms such as cognitive impairment related to small cerebral vasculopathy of a patient, and / or anxiety and depression, and / or sleep disorder and the like. In-vitro experiments prove that the traditional Chinese medicine composition has a protection effect on human brain microvascular endothelial cell injury caused by hypoxia and reoxygenation, and can promote cell proliferation and inhibit cell apoptosis. Therefore, the traditional Chinese medicine composition can be applied to prevention and / or treatment of clinical symptoms related to small cerebral vasculopathy under the pathological mechanism of pulse stagnation and collateral arthralgia.

The application discloses a new use of androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione, namely, application of the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione in preparation of a medicine for treating lymphoma. 50 The IC value of the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione in the SR cell line is detected by a CCK-8 method, and the cytotoxicity of the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione on human umbilical vein endothelial cells Huvce and human immortalized keratinocytes Hacat is detected, in the body, the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione significantly inhibits tumor growth and shows good biological safety and no systemic toxicity; TUNEL staining, gamma-H2AX staining and neutral comet experiment prove that the compound of the application inhibits the growth of SR by causing serious damage to DNA, the application not only adds the diversity of the biological activity of the androsta-4,6,8(9),13(14)-tetraen-3,11,16-trione, but also provides a new direction for developing a new medicine for treating lymphoma.

The application discloses a polypeptide for targeting antagonizing pCAV1 and application thereof, and relates to the technical field of biology.The polypeptide is any one of the amino acid sequences shown in (1) and (2): (1) has the amino acid sequence shown in SEQ ID NO:1: VHPKQHRGGSKGCGGYGRKKRRQRRRGGFIYVNQSFAPK; and has the amino acid sequence shown in SEQ ID NO:1, and a polypeptide derivative obtained by modifying, substituting or adding one or more amino acid sites in the amino acid sequence.The application first excavates an antagonistic short peptide (namely CBM polypeptide) which can target p-caveolin-1 (pCAV1), can specifically block the combination of pCAV1 and ATG12-ATG5 compound to activate the autophagy process of endothelial cells, and can reduce the amount of low-density lipoprotein (LDL) crossing the endothelial cells, and it is proved that the polypeptide can effectively delay the progress of early atherosclerotic plaques.

The invention belongs to the technical field of biology, and particularly relates to an in-situ spray polymerization coating started by bacterial exovesicles (LBEVs) as well as a preparation method and application of the in-situ spray polymerization coating. And functionalizing the LBEVs by Fe < 3 + > through electrostatic adsorption to obtain an LBEVs-Fe < 3 + > solution. After LBEVs-Fe < 3 + > and pyrrole monomers are sprayed on a wound part, the LBEVs-Fe < 3 + > initiates pyrrole to be oxidized and polymerized into polypyrrole, and a polymerized coating LBEVs-PPy is formed. The LBEVs show effective antibacterial activity on staphylococcus aureus, escherichia coli and staphylococcus epidermidis, near-infrared triggered photo-thermal activation generates mild thermal therapy, expression of angiogenesis regulatory factors (such as VEGFA and ANGPT1) in human umbilical vein endothelial cells (HUVECs) is remarkably up-regulated, and an HSP90 / p-eNOS pathway is activated to accelerate angiogenesis, so that the activity of the LBEVs is improved. The LBEVs-PPy coating remarkably accelerates wound healing through a synergistic mechanism integrating the strong antibacterial activity of LBEVs and the efficient photo-thermal characteristic of PPy.

The invention discloses a method for detecting fish gelatin protein based on Cu-MOF (at) PDA (at) PBA and bionic intestinal villus micro-tissues, and belongs to the technical field of electrochemical sensors and food safety detection. The preparation method comprises the following steps: taking polydopamine modified Cu-MOF as a substrate to preliminarily fix template molecules, and taking 3, 5-difluorophenylboronic acid as a functional monomer to form Cu-MOF (at) PDA (at) PBA / MIPs; then adding the conductive hydrogel, mast cells and endothelial cells into a methacrylated gelatin solution to prepare conductive hydrogel; carrying out 3D printing on the bionic small intestine villus micro-tissue; adhering the bionic intestinal villus micro-tissue to a PDMS (Polydimethylsiloxane) base electrode to obtain a hydrogel electrode; then, by taking the hydrogel electrode as a working electrode, establishing a three-electrode system, and constructing an electrochemical bionic intestinal villus micro-tissue sensor; and finally detecting the fish gelatin protein, wherein the detection limit is as low as 0.051 ng / mL.

The invention relates to the technical field of cell biology, in particular to a method for extracting and purifying chicken primary brain microvascular endothelial cells. The method for extracting and purifying the chicken primary brain microvascular endothelial cells comprises the following steps: (1) acquiring and pretreating chicken embryo brain tissues; (2) primary enzyme digestion; (3) removing myelin sheath; (4) secondary enzyme digestion; (5) performing Percoll gradient centrifugal purification; and (6) performing differential adherent cell culture and screening. According to the chicken primary brain microvascular endothelial cell extraction and purification method, through collaborative optimization of double enzyme digestion, demyelination treatment and Percoll gradient centrifugation, the purity of separated cells is remarkably improved, the cell survival rate is high, the cost is low, consumed time is short, and the method is suitable for large-scale preparation.

The application provides a chronic hypoperfusion animal model construction method and application thereof, and relates to the field of biomedical technology. The chronic hypoperfusion animal model construction method provided by the application is aimed at brain capillary endothelial cells, and the chronic hypoperfusion animal model constructed by the method is global and persistent brain hypoperfusion, has no risk of infection or death, and has low cost. The animal model constructed by the application is more convincing in reperfusion research and drug efficacy evaluation.

The invention relates to a circular non-coding RNA (Ribonucleic Acid) sno-circCNOT1 and application thereof, and belongs to the technical field of medicine. The invention provides a circular non-coding RNA (Ribonucleic Acid), the nucleotide sequence of the circular non-coding RNA is shown as SEQ ID NO: 1, and the circular non-coding RNA is named as sno-circCNOT1. The invention identifies a novel snoRNA-like annular non-coding RNA, the novel snoRNA-like annular non-coding RNA is named as sno-circCNOT1, the expression of the novel snoRNA-like annular non-coding RNA is adjusted by shear force, and the novel snoRNA-like annular non-coding RNA can promote NLRP3-dependent inflammatory response and pyroptosis of endothelial cells by combining nucleofibrin and stabilizing METTL14 protein, thereby aggravating blood flow shear force and atherosclerosis induced by high fat diet. Therefore, the compound can be used as a target for relieving inflammatory response and pyroptosis of endothelial cells and treating atherosclerosis.

The invention discloses a construction method and application of an adeno-associated virus vector of a targeted vascular endothelial cell, and belongs to the technical field of genetic engineering. The construction method and the application comprise the following steps: S1, vector construction: cloning a Tie2-eNOS promoter to a pAAV-MCS plasmid, so as to obtain pAAV-Tie2-MCS; the preparation method comprises the following steps: carrying out PCR (Polymerase Chain Reaction) amplification on a VEGF (Vascular Endothelial Growth Factor) gene, and inserting the VEGF gene into a pAAV-MCS plasmid to obtain an expression plasmid pAAV-Tie2- The method comprises the following steps: carrying out combined mutation on a VP1 gene of a pAAV-RC6 plasmid to obtain a mutant plasmid pAAV-RC6; s2, virus packaging and purification: culturing an HEK293 cell, and transfecting a pAAV-Tie2-VEGF (Vascular Endothelial Growth Factor), a mutant plasmid pAAV-RC6 and a pHelper plasmid; performing chromatographic purification by combining iodixanol gradient centrifugation with Heparin, so as to obtain rAAV; and S3, carrying out titer determination, SDS-PAGE (Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis) and in vitro and in vivo experiment detection on the rAAV. The preparation process is simple, the titer greater than or equal to 1 * 10 < 13 > vg / mL can be obtained through single transfection, and the production cost is reduced; and mutation screening is realized through a directed evolution technology, so that the experimental period is shortened. And the vector provided by the invention has relatively high specificity on vascular endothelial cells.

Sickle cell disease (SCD) is a single gene disorder characterized by mutant hemoglobin-S (HbS) and chronic intravascular haemolysis. Painful vaso-occlusive crises (VOC) are typical of SCD and often associated to a further rise in hemolysis. VOC is the clinically painful form of vaso-occlusion, that is due to the aggregation of red blood cells in the capillaries and venules. Such event is promoted or aggravated by adhesion of polymorphonuclear neutrophils (PMNs) to red blood cells and the endothelium leading to tissue ischemia, inflammation and imperfect repair. Repeated vaso-occlusion and PMNs interactions with the vascular endothelium are thought to promote microvascular injuries in SCD patients. The inventors tested the effect of pharmacological inhibition of TREM-1 with LR12 peptide in two experimental vaso-occlusive crisis models. Additional validation of TREM-1 involvement in vaso-occlusion was verified using mice with sickle cell disease and Trem-1 gene deficiency. In particular, the inventors showed that TREM-1 inhibition is particular suitable for limiting the severity of vaso-occlusions. The results obtained by the inventors also suggest that plasmatic concentration of sTREM-1 could be a reliable biomarker for predicting vaso-occlusions and / or SCD-associated organ dysfunction and end-organ damage.

The present invention relates to a method for assessing myocardial infarction comprising the steps of determining the amount of a first biomarker in a sample of a subject, said first biomarker being cMyBPC, determining the amount of a second biomarker in a sample of the subject, wherein said second biomarker is selected from the group consisting of: a BMP10-type peptide (Bone Morphogenic Protein 10-type peptide), FGF23 (Fibroblast growth factor 23), a BNP-type peptide (Brain natriuretic peptide type peptide), GDF-15 (Growth differentiation factor 15), ANG2 (Angiopoietin 2), CRP (C-reactive protein), ESM1 (endothelial cell specific molecule 1), or a lipid biomarker, such as Cholesterol, LDL (Low Density Lipoprotein) or APOAT (Apolipoprotein A-1) comparing the amounts of the biomarkers to references for said biomarkers and / or calculating a score for assessing myocardial infarction based on the amounts of the biomarkers, and assessing said subject based on the comparison and / or the calculation. The invention also relates to the use of a first biomarker being cMyBPC and a second biomarker selected from the group consisting of: a BMP10-type peptide, FGF23, a BNP-type peptide, GDF15, ANG2, CRP (C-reactive protein), ESM1, or a lipid biomarker, such as Cholesterol or LDL, or at least one detection agent for said first biomarker and at least one detection agent for said second biomarker for assessing myocardial infarction. Moreover, the invention further relates to a computer-implemented method for assessing myocardial infarction and a device and a kit for assessing myocardial infarction.

A nucleic acid molecule comprising: a first polycistronic cassette comprising: TFPI (EPI / LACI), EPCR (PROCR), and thrombomodulin (THBD); a second polycistronic cassette comprising: B2M HLA-E fusion pr

The invention belongs to the field of medicine application, and particularly relates to application of polygonum multiflorum and an extract thereof in preparation of a medicine for repairing diabetic wounds. Cell experiments show that the polygonum multiflorum ethanol extract has remarkable in-vitro antioxidant activity and good cell safety, and can effectively enhance proliferation, migration, apoptosis resistance and oxidative stress resistance of human umbilical vein endothelial cells in a high-glucose environment by activating a P62-Keap1-Nrf2 signal channel. Animal experiments further prove that the extracting solution can remarkably accelerate wound healing of diabetic mice, relieve local inflammation infiltration, increase the collagen content, promote transformation of the diabetic mice to mature collagen and reduce the oxidative stress level of tissues at the same time. The treatment effect of the radix polygoni multiflori is equivalent to that of a clinical common drug basic fibroblast growth factor, and the radix polygoni multiflori has a wide application prospect in the aspect of wound repair of diabetes mellitus.

The application provides a nucleic acid molecule, a pro-angiogenic mesenchymal stromal cell and application thereof, relates to the biomedical technical field, and the nucleic acid molecule encodes HGF protein, or encodes VEGF165 protein and HGF protein; a first signal peptide is used as the signal peptide of the VEGF165 protein, and a second signal peptide is used as the signal peptide of the HGF protein. Through a gene modification strategy, MSC cells containing the nucleic acid molecule can stably and efficiently express VEGF165 and / or HGF, and the expression amount is significantly higher than that of MSC without the nucleic acid molecule. The cells have the ability to promote the migration of endothelial cells; meanwhile, the cells can also significantly promote the proliferation and tube formation of HUVEC cells, and further confirm the strong pro-angiogenic effect. The technical problem that nucleic acid molecules expressing VEGF165 or / HGF cannot be stably and efficiently expressed in the prior art is solved.

The application discloses a method for conditionally inducing in zebra fish for researching kdrl (vegfr2) gene in blood vessel growth research, which comprises the following steps: (1) preparing a kdrl conditional knock-out strain by using non-homologous end connection; (2) crossing a transgenic strain for marking blood vessel endothelial cells with the kdrl conditional knock-out strain to establish a double-transgenic strain; and (3) injecting Cre mRNA into embryos generated by crossing the double-transgenic strain to realize kdrl knock-out, and observing and evaluating the abnormality of blood vessel growth through fluorescence.

The application discloses a cell monomolecular mechanical force sensor for detecting a cell phagocytosis process, a preparation method and application thereof, and the sensor comprises a microsphere substrate and a plurality of double-stranded DNA mechanical probes modified on the surface of the microsphere substrate; the probes are composed of a first single-stranded DNA and a partially complementary second single-stranded DNA, and form a FRET or fluorescence quenching pair; when a cell exerts a pulling force on the probes through receptor-ligand interaction during phagocytosis or wrapping of the microsphere and the pulling force exceeds a preset melting threshold, the double-stranded DNA is melted or conformationally changed and a fluorescence signal change is generated, so that detection of a single-molecule level mechanical force at a phagocytosis interface is realized. By adjusting a geometric conformation and sequence design of the probes, a probe library with different melting force thresholds can be constructed, quantitative analysis and spatial distribution characterization of mechanical forces during phagocytosis are realized. The application can truly simulate a three-dimensional phagocytosis interface, and provides an effective tool for revealing a mechanism of blood flow mechanics regulating endothelial cell phagocytosis behavior and drug screening related to diseases.

The invention relates to a microparticle comprising a core and a membrane surrounding the core, wherein the membrane comprises a cell membrane component. A method for transporting the microparticle is provided. The transport method comprises administering the microparticle to an endothelium, whereby the microparticle is bound to the endothelium; and moving the microparticle across the endothelium. Also provided is a method for preparing the microparticle.

The application discloses a Ceylonus sea wood ear polysaccharide with improved endothelial cell dysfunction and glycolipid metabolism disorder functions, and the polysaccharide is extracted from Ceylonus sea wood ear by using a composite enzyme. The application not only provides a theoretical basis for high-value utilization of the Ceylonus sea wood ear, but also provides a new idea for disease prevention and treatment.

The receptor for advanced glycation end-products (RAGE) is a multi-ligand receptor member of the immunoglobulin super family which is able to bind Aβ peptide and 3-sheet fibrils. It is expressed in endothelial cells, smooth muscle cells, microglia and neurons, and is implicated in the transport of Aβ through the blood-brain barrier (BBB), oxidative stress-mediated neurotoxicity, and adverse microglia inflammatory responses. The interaction between RAGE and its ligands is thought to result in pro-inflammatory gene activation. Enhanced levels of RAGE ligands in Alzheimer's disease are thought to contribute to the cause of this disorder. Embodiments of the invention use the RAGE multi-ligand site as an anchoring loci for a conversion electron emitting compound rather than as a receptor to intrinsically activate or block inflammation through the RAGE intracellular cascade through activation of the RAGE cytoplasmic tail (ctRAGE) and mammalian diaphanous 1 (DIAPH1).