18 results about "Shewanella putrefaciens" patented technology

The invention provides a marine microorganism mineralization coating and a preparation method thereof, and relates to the field of marine anti-corrosion coatings. The preparation method of the marine microorganism mineralization coating comprises the following steps: after carrying out sterile treatment on a target metal material, immersing the target metal material into a shewanella putrefaciens culture solution for first culture to obtain a metal material with a biological membrane; and adding L-calcium aspartate into the shewanella putrefaciens culture solution to obtain a biomineralization nucleation solution, and carrying out second culture to obtain the metal material with the marine microorganism mineralization coating. According to the method provided by the invention, an inorganic calcium source L-calcium aspartate is inoculated to regulate and control a carbonate layer formed by inducing shewanella putrefaciens. The form of the microorganism mineralization coating mediated and regulated by the L-calcium aspartate is converted into a flagstone shape from a general calcite crystal form, and the microorganism mineralization coating which is more compact, smoother and more stable is formed and has excellent corrosion resistance.

The invention relates to an electroactive microbial system for removing parachlorophenol and a method thereof, and aims to provide an electroactive microbial strain for reducing Fe < 0 > oxidized under the condition of oxygen, generating active Fe < 2 + > and further removing parachlorophenol, so that the defect that Fe < 0 > is easy to passivate when organic pollutants are treated is overcome. In addition, an allogenic material is also introduced, so that the degradation efficiency of the electroactive microorganism enhanced zero-valent iron aeration system on 4-CP is improved; the operation is simple, the cost is low, and meanwhile, the pollution to the environment is avoided; according to the technical scheme, the electroactive microbial system for removing parachlorophenol comprises the following components: 0.08 g / L to 0.60 g / L of zero-valent iron, 0.5 mmol / L to 5.0 mmol / L of allogenic substances and 5 g / L to 40 g / L of electroactive microbial strains, the electroactive microbial strains are shewanella decolorata S12 and shewanella putrefaciens SP200, and the electroactive microbial strains are prepared from the shewanella decolorata S12; the microbial inoculum is at least one of shewanella sp. MR-1 and sulfur reduction geobacter PCA; belongs to the field of environmental microorganisms.

The invention discloses application of perillaldehyde in inhibiting formation of a shewanella putrefaciens biofilm, and belongs to the technical field of microorganisms. Perillaldehyde not only can inhibit the formation of a shewanella putrefaciens biofilm in the culture medium, but also can effectively inhibit the formation of the shewanella putrefaciens biofilm on the surface, the contact surface or the interior of the aquatic product. The perillaldehyde is safe in component and free of fragrance, can be used as a food additive, and has a wide application prospect in food antibiosis.

The invention discloses an on-line monitoring method for a shewanella persea biofilm based on a hyperspectral technology, and belongs to the technical field of food detection.The method comprises the steps that firstly, microscopic hyperspectral data of the biofilm in different growth stages are collected under a pure culture system, and after pretreatment, the hyperspectral data are obtained; variance analysis and LASSO, SPA or PLS-VIP and other methods are adopted for composite feature screening, and key feature wavelengths are extracted; constructing and training a qualitative classification model based on the key characteristic wavelengths to realize accurate classification of growth stages; and then migrating the model which is verified to be valid to a food system, performing stage identification on the biofilm on the surface of the food, and finally generating a visual image reflecting the spatial distribution of the biofilm. According to the method, reliable migration from a laboratory to an actual application scene is realized, and non-destructive, dynamic and visual online identification and spatial analysis can be carried out on the growth stage of the biofilm.

The invention relates to the technical field of food preservation, in particular to hydrogel containing an electric field response antibacterial material as well as a preparation method and application of the hydrogel. The hydrogel is prepared from the following raw materials in parts by weight: 0.1 to 0.2 part of an electric field response antibacterial material; 2-5 parts by weight of polyvinyl alcohol; 0.5-3 parts by weight of amyloid protein fiber; 30-40 parts by weight of glycerin; and 0.3-0.5 part by weight of sodium chloride. The electric field response antibacterial hydrogel prepared by the invention has the capability of generating active oxygen such as superoxide anions, singlet oxygen and hydroxyl radicals, and has a good in-vitro antibacterial effect on aquatic product putrefying bacteria (shewanella putrefaciens).

The invention discloses shewanella putrefaciens bacteriophage SpuP2 and application thereof. The preservation number of the shewanella putrefaciens bacteriophage SpuP2 is CCTCC (China Center For Type Culture Collection) NO: M 20251492. The method belongs to the brachycauda family. The titer of a lysate prepared based on the bacteriophage is 108-9PFU / mL, and the lysate can be stably applied under the conditions that the temperature is less than or equal to 50 DEG C and the pH is 5-10. The bacteriophage and the preparation thereof can efficiently inhibit the growth of shewanella putrefaciens, significantly inhibit the formation of a biofilm, remove a mature biofilm, and achieve a sterilization rate of 99-99.99% in aquatic products such as grass carp fillets and the like. The preparation is safe and residue-free, can replace a chemical antibacterial agent to be used for rot prevention and control in the food storage, transportation and processing processes, and has good safety and application prospects.

The present application relates to a kind of microbial inoculant, specifically to a kind of microbial inoculant for improving subtropical secondary forest soil quality, belong to the field of biotechnology.The microbial inoculant includes A component, B component and C component;The A component includes Bacillus subtilis, Bacillus amyloliquefaciens and Bacillus mucilaginosus;The B component includes Shewanella putrefaciens, Podospora sp. And Burkholderia sp.;The C component includes superphosphate, adhesive, soil bulking agent and water.The microbial inoculant is generated by the microbial growth-metabolism-death process of microbial residue carbon and nutrient, green, efficiently improve subtropical secondary forest soil organic matter content, phosphorus-solubilizing nitrogen-fixing, improve soil microbial community structure, promote secondary forest positive succession.

The present application relates to the technical field of biological detection, and particularly relates to a primer probe, a kit and an application for detecting pathogenic shewanella putrefaciens. The present application takes the gyrB gene of shewanella putrefaciens as a target, and a specific primer and a fluorescent probe combination are obtained through screening, so that the rapid detection of shewanella putrefaciens by fluorescence quantitative PCR can be successfully realized. The method has the advantages of high sensitivity, strong specificity, good repeatability and the like, has no cross reaction with other common aquatic pathogenic bacteria, can realize the accurate screening of pathogens in the early stage of bacterial diseases of silver carp and bighead carp, and provides a reliable technical means for the early warning and prevention and control of the epidemic caused by shewanella putrefaciens in aquaculture production.

The application discloses an antagonistic bacterium of pathogenic shewanella of Apostichopus japonicus and application thereof, and belongs to the technical field of aquatic microorganisms. Gilvus japonicus The antagonistic bacterium is separated from the intestinal tract of healthy Apostichopus japonicus and is identified as Japanese Yellow Sea Oceanic Bacterium (Shewanella japonica), has no beta-hemolysis characteristic, is safe and non-toxic to Apostichopus japonicus, and can significantly antagonize the pathogenic bacterium Shewanella of Apostichopus japonicus skin rot syndrome. The application also discloses application of the antagonistic bacterium, which can be prepared into an aquatic microecological preparation for preventing and treating the skin rot syndrome of Apostichopus japonicus, and is applied through intraperitoneal injection or immersion, so that the survival rate of Apostichopus japonicus under exposure of the pathogenic bacterium is significantly improved. The strain has strong salt and alkali resistance, tolerances to various antibiotics and chemical drugs, and strong environmental adaptability, can be applied to the cultivation of Apostichopus japonicus to replace traditional antibiotics, effectively solves the problems of food safety and environmental pollution caused by the abuse of antibiotics, and has good industrial application prospect.

The invention discloses an antibacterial peptide and application thereof. The antibacterial peptide is selected from any one of the following polypeptides: SEQ ID NO: 1: MRCFKRLIKVFLIARKR, SEQ ID NO: 2: MRCFKRLIKVFLIARKR, and SEQ ID NO: 3: MRCFKRLIKVFLIARKR. The molecular marker is shown as SEQ ID NO: 2: MWIAANKTLFSSRKMMAIICVVLIFPGIAAA, and the molecular marker is shown as SEQ ID NO: 2. And the SEQ ID NO: 3: MSRSKATCLYFFRCAINALT is shown in the description. According to the antibacterial peptide as well as the preparation method and the application thereof, a series of novel antibacterial peptides are obtained through screening and optimization design of a genome sequence of lactobacillus plantarum, and compared with other antibacterial peptides and the antibacterial peptide LP2140, the antibacterial peptide has a better antibacterial effect, can effectively inhibit growth of shewanella putrefaciens, can prevent aquatic products from being preserved and fresh, and has a good application prospect. The invention provides a new thought for the preservation technology of aquatic products, and provides theoretical support and practical reference for food safety and quality assurance.

The invention relates to the technical field of aquatic animal breeding, in particular to application of bacillus velezensis in biological prevention and treatment of aeromonas of aquatic animals. According to the application, the bacillus velezensis is found to have a relatively strong antagonistic effect on common aquatic pathogenic bacteria such as aeromonas hydrophila, aeromonas sobria, aeromonas cainea, aeromonas veronii, aeromonas salmonicida, pseudomonas fluorescens, shewanella putrefaciens, plesiomonas shigelloides and edwardsiella catfish, and the strain has no hemolytic activity; the strain does not carry common virulence genes of bacillus, is sensitive to most antibacterial drugs, and has no pathogenicity to grass carp. Therefore, the bacillus velezensis is an aeromonas antagonistic bacterium with good safety, can be used as a potential probiotic for preventing and treating aeromonas diseases of aquatic animals, and has a good application prospect.

The present invention discloses an anode solution of a microbial fuel cell and a microbial fuel cell based on Shewanella, wherein the anode solution comprises an electron donor, a basal medium, a buffer solution and bacterial cells, and the bacterial cells are a mixed flora of Shewanella putrefaciens and Shewanella xiamenensis with a quantity ratio of 1:1; the microbial fuel cell adopts the above anode solution, so it has a relatively high output voltage and electric power and has a broad application prospect.

The invention relates to the technical field of molecular detection of pathogenic microorganisms, in particular to a group of PCR (Polymerase Chain Reaction) primer pairs for detecting pathogenic shewanella putrefaciens of crucian carps, a product and application of the PCR primer pairs. The nucleotide sequences of the PCR primer pair are as shown in SEQ ID NO. 1 and SEQ ID NO. 2. Based on the PCR primer pair, the invention also develops a detection kit which comprises an upstream primer, a downstream primer, 2 * Taq Plus PCR MIX, a standard positive template DNA, a negative control solution and ddH2O. The PCR primer pair provided by the invention fills the blank of detecting the pathogenic shewanella putrefaciens of the crucian carp, has a good amplification effect on detecting the pathogenic shewanella putrefaciens of the target crucian carp, and has remarkable specificity and relatively high detection sensitivity.

The invention belongs to the technical field of food, and discloses pomegranate peel-clove essential oil nano microemulsion as well as a preparation method and application thereof. A conversion method is adopted for preparation, clove essential oil is used as an oil phase, a pomegranate peel aqueous solution containing a mixed surfactant is used as a water phase, and filling or high-pressure homogenization is performed to prepare the clove essential oil-containing pomegranate peel essence. The prepared microemulsion is uniform in structure, free of layering and precipitation and good in fluidity, is in an O / W type, has the particle size between 93.76 + / -2.08 nm and 257.62 + / -19.49 nm, does not produce layering after being centrifuged for 15 minutes, and keeps stable after being placed at normal temperature for 30 days. The pomegranate peel essential oil has a bacteriostatic effect on food spoilage bacteria (shewanella putrefaciens, pseudomonas fluorescens and pseudomonas aeruginosa), it is determined that the pomegranate peel and the clove essential oil have a synergistic effect, and the FIC of the pomegranate peel and the FIC of the clove essential oil are 0.25, 0.5 and 0.5 respectively. The microemulsion can provide reference for solubilizing application and bacteriostatic ability improvement of plant extracts researched and developed by production enterprises and scientific research institutions.

The present invention discloses the application of Paenibacillus provencensis PP-2 or its fermentation extract in the preservation of sea bass, in the preparation of a preparation for the preservation of sea bass, in the inhibition of Shewanella putrefaciens and / or Pseudomonas fragi, and in the preparation of a preparation having the efficacy of inhibiting Shewanella putrefaciens and / or Pseudomonas fragi. Research shows that Paenibacillus provencensis PP-2 can effectively inhibit Shewanella putrefaciens and Pseudomonas fragi, the dominant bacteria screened from Lateolabrax japonicus, and can be used for the preservation of sea bass, which has high economic value and is of great significance for the preservation of aquatic products. The present invention expands the uses of Paenibacillus provencensis PP-2 and is of great significance for the industrial application of Paenibacillus provencensis PP-2.

The invention discloses a traditional Chinese medicine composition for inhibiting shewanella putrefaciens and application of the traditional Chinese medicine composition, and relates to the technical field of biological medicines. The traditional Chinese medicine composition comprises any two of gallnut, myrobalan and clove. The invention develops the traditional Chinese medicine composition for inhibiting shewanella putrefaciens, the traditional Chinese medicine composition is compounded from any two of gallnut, myrobalan and clove, the traditional Chinese medicine composition shows a synergistic bacteriostatic effect through experimental verification, the bacteriostatic effect is greatly improved compared with that of a single Chinese herbal medicine, the shewanella putrefaciens proliferation can be rapidly inhibited, and the anti-bacterial effect is good. The spreading and pathogenic processes of the bacillus subtilis in aquatic water and aquatic animal bodies are effectively blocked. The traditional Chinese medicine composition depends on natural Chinese herbal medicine raw materials, is low in toxicity and free of residues, can be prepared into a special antibacterial medicine for aquatic products, prevents and controls diseases such as gill rot and enteritis through oral administration or external application, and reduces the death rate of bred animals; the composition can also be prepared into a water body disinfectant to disinfect culture ponds, tools and the like, so that the pathogen transmission path is cut off from the source.

The present application relates to the technical field of soil improvement, and discloses a porous composite microbial agent for promoting nitrate reduction to produce ammonium, a preparation method and application thereof.The porous composite microbial agent is a modified porous mineral loaded with microorganisms having nitrate reduction capacity; the microorganisms having nitrate reduction capacity include at least one of Klebsiella pneumoniae, pseudomonas nitritireducen and Shewanella putrefaciens strain CN32.The porous composite microbial agent provided by the present application can promote the efficiency and rate of conversion of nitrate or nitrite to ammonium nitrogen, reduce nitrogen loss and greenhouse gas generation, has a compact structure, good stability and can continuously play a role; the porous composite microbial agent is applied to the process of strengthening soil nitrate dissimilatory reduction to ammonium, and can reduce soil nutrient loss and air pollution.